NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS80321.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
80321.1 Public Mus musculus 5 Smr2 23 108 98 CCDS HistoryNCBI Gene:20600Re-query CCDS DB by CCDS ID:80321.1Re-query CCDS DB by GeneID:20600See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 80321.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000196477.4 ENSMUSP00000142688.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000196477.4Link to Ensembl Protein Viewer:ENSMUSP00000142688.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000196477Re-query CCDS DB by Protein ID:ENSMUSP00000142688
Original member Current member EBI ENSMUST00000196070.1 ENSMUSP00000143443.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000196070.1Link to Ensembl Protein Viewer:ENSMUSP00000143443.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000196070Re-query CCDS DB by Protein ID:ENSMUSP00000143443
Original member Current member NCBI NM_001252679.1 NP_001239608.1 Accepted alive Link to Nucleotide Sequence:NM_001252679.1Link to Protein Sequence:NP_001239608.1Re-query CCDS DB by Nucleotide ID:NM_001252679Re-query CCDS DB by Protein ID:NP_001239608Link to BLAST:NP_001239608.1
Original member Current member NCBI NM_001252680.1 NP_001239609.1 Accepted alive Link to Nucleotide Sequence:NM_001252680.1Link to Protein Sequence:NP_001239609.1Re-query CCDS DB by Nucleotide ID:NM_001252680Re-query CCDS DB by Protein ID:NP_001239609Link to BLAST:NP_001239609.1
Original member Current member NCBI NM_001252681.1 NP_001239610.1 Accepted alive Link to Nucleotide Sequence:NM_001252681.1Link to Protein Sequence:NP_001239610.1Re-query CCDS DB by Nucleotide ID:NM_001252681Re-query CCDS DB by Protein ID:NP_001239610Link to BLAST:NP_001239610.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001239608.1 143 O35979-1 143 100% 0 0
NP_001239609.1 143 O35979-1 143 100% 0 0
NP_001239610.1 143 O35979-1 143 100% 0 0

Chromosomal Locations for CCDS 80321.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 88105329 88105382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88108519 88108896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (432 nt):
ATGAAGCCACTGTGTTTGGTCTTTGGCCTCTGTGTTCTTATAGGATGCTTCCTTTCTAGTGAGTGCCAAA
GA
GGCTTCAGAGGACAGCATGATCCTACAAGACCACTATCTCCTTCAAATCCTTCTTCTCATTTTTATCC
T
CAGCCTGATCCCAATCGTGTACAGATTTCTCAACCAGACAATATCCCCATTTTCATGTTTGAACAACCA
CAT
TCTCTTAATATTTGTGTTCCTCCTCCTCCTTTATACCTTGGAGAAGAATTTGAAAAACTACCTCCTA
AT
ACTCATATTCCTTATATACTAATACGTCCAGATATTGAACCTCCAAGCAAATATATTCAACCAGTTCC
C
AGAAAAAAATCAAATGCAACACCAGCTGCCAATAACTTTATAACTACTGCTACTGCCCCCAATTCTACT
GAT
AGCTTTTGA


Translation (143 aa):
MKPLCLVFGLCVLIGCFLSSECQRGFRGQHDPTRPLSPSNPSSHFYPQPDPNRVQISQPDNIPIFMFEQP
H
SLNICVPPPPLYLGEEFEKLPPNTHIPYILIRPDIEPPSKYIQPVPRKKSNATPAANNFITTATAPNST
D
SF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser