NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27218.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27218.1 Public Mus musculus 14 Ephx2 23 108 98 CCDS HistoryNCBI Gene:13850Re-query CCDS DB by CCDS ID:27218.1Re-query CCDS DB by GeneID:13850See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27218.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000070515.1 ENSMUSP00000069209.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070515.1Link to Ensembl Protein Viewer:ENSMUSP00000069209.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000070515Re-query CCDS DB by Protein ID:ENSMUSP00000069209
Original member Current member NCBI NM_007940.4 NP_031966.2 Accepted alive Link to Nucleotide Sequence:NM_007940.4Link to Protein Sequence:NP_031966.2Re-query CCDS DB by Nucleotide ID:NM_007940Re-query CCDS DB by Protein ID:NP_031966Link to BLAST:NP_031966.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031966.2 554 P34914-1 554 100% 0 0

Chromosomal Locations for CCDS 27218.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 66084682 66084760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66084931 66084989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66085296 66085376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66086234 66086303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66086965 66087067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66088300 66088333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66089506 66089580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66092799 66092910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66094738 66094823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66095686 66095712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66098804 66098838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66101593 66101671 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66102147 66102242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66103726 66103794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66107214 66107336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66107977 66108167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66110116 66110275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66116711 66116795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66124335 66124435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1665 nt):
ATGGCGCTGCGTGTAGCCGCGTTCGACCTTGACGGAGTGCTGGCCCTCCCCTCTATCGCCGGGGCTTTCC
GC
CGCAGCGAAGAGGCCCTGGCACTGCCTAGAGACTTCCTGCTTGGTGCGTACCAGACGGAATTCCCAGA
G
GGACCCACTGAGCAACTCATGAAAGGGAAGATCACATTTTCGCAGTGGGTACCACTCATGGATGAAAGC
TAC
AGGAAGTCCTCCAAAGCCTGTGGAGCCAATCTACCTGAGAATTTCTCCATAAGTCAAATATTCAGCC
AA
GCTATGGCAGCAAGAAGCATCAACCGCCCCATGCTTCAGGCAGCCATTGCTCTCAAAAAGAAAGGATT
C
ACAACATGCATTGTCACCAACAACTGGCTGGACGACGGAGACAAGAGAGACAGCCTGGCCCAGATGATG
TGT
GAGCTGAGCCAACACTTTGACTTCCTGATAGAGTCCTGTCAGGTTGGGATGATCAAGCCTGAGCCTC
AG
ATCTACAATTTTTTACTGGATACCCTGAAGGCAAAACCCAATGAGGTTGTTTTCCTAGATGACTTTGG
A
AGTAATCTGAAGCCAGCCCGTGACATGGGGATGGTTACCATCCTGGTCCACAACACAGCCTCCGCTCTG
AGA
GAACTGGAGAAGGTCACAGGGACACAGTTTCCTGAGGCCCCACTGCCAGTCCCATGCAATCCAAATG
AC
GTCAGCCATGGATATGTGACAGTGAAGCCAGGGATCCGCCTGCATTTTGTGGAGATGGGCTCTGGCCC
T
GCCCTATGCCTTTGCCATGGGTTTCCTGAGAGCTGGTTTTCTTGGAGGTACCAGATCCCTGCTCTGGCC
CAG
GCAGGCTTTCGTGTTCTGGCTATAGACATGAAAGGCTATGGAGACTCATCTTCTCCTCCTGAAATAG
AA
GAATATGCCATGGAATTGCTGTGTAAGGAGATGGTGACATTCCTGGATAAGCTGGGAATCCCTCAAGC
A
GTGTTCATTGGCCATGACTGGGCTGGTGTGATGGTGTGGAACATGGCTCTCTTCTACCCTGAGAGAGTG
AG
G
GCTGTGGCCAGTTTGAACACGCCGTTTATGCCACCAGATCCTGATGTGTCTCCCATGAAAGTTATCC
GA
TCTATCCCAGTTTTCAATTATCAGCTGTACTTTCAAGAACCAGGAGTGGCCGAGGCTGAACTGGAGAA
G
AACATGAGTCGGACTTTCAAAAGCTTCTTCCGAGCCAGTGATGAGACAGGTTTCATCGCTGTGCATAAA
GCC
ACTGAAATAGGGGGAATCCTTGTGAATACTCCAGAAGATCCCAACCTCAGCAAAATTACTACTGAGG
AA
GAAATAGAGTTTTACATACAGCAGTTCAAGAAGACTGGCTTCAGAGGTCCTCTGAACTGGTACCGGAA
C
ACAGAAAGAAACTGGAAGTGGAGCTGTAAAGGGTTGGGACGAAAGATCTTGGTCCCAGCCCTGATGGTC
ACA
GCTGAGAAGGACATTGTACTCCGTCCTGAAATGTCCAAGAACATGGAAAAGTGGATCCCTTTCCTGA
AA
AGGGGACACATTGAAGACTGTGGTCACTGGACACAGATAGAGAAACCAACTGAGGTGAACCAGATTCT
C
ATCAAGTGGCTGCAGACTGAAGTCCAGAACCCATCAGTGACCTCCAAGATTTAG


Translation (554 aa):
MALRVAAFDLDGVLALPSIAGAFRRSEEALALPRDFLLGAYQTEFPEGPTEQLMKGKITFSQWVPLMDES
Y
RKSSKACGANLPENFSISQIFSQAMAARSINRPMLQAAIALKKK
GFTTCIVTNNWLDDGDKRDSLAQMM
C
ELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNE
VVFLDDFGSNLKPARDMGMVTILVHNTASAL
R
ELEKVTGTQ
FPEAPLPVPCNPNDVSHGYVTVKPGIRLHFVEMGSGPALCLCHGFPESWFSWRYQIPALA
Q
AGFRVLAIDMKGYGDSSSPP
EIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAGVMVWNMALFYPERV
R
AVASLNTPFMPPDPDVSPMKVIRSIPVFNYQLYFQEPGVAEAELEKNMSRTFKSFFRASDETGFIAVHK
A
TEI
GGILVNTPEDPNLSKITTEEEIEFYIQQFKKTGFRGPLNWYRNTERNWKWSCKGLGRKILVPALMV
T
AEKDIVLRPEMSKNMEKW
IPFLKRGHIEDCGHWTQIEKPTEVNQILIKWLQTEVQNPSVTSKI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser