NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS88694.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
88694.1 Public Mus musculus 14 Ephx2 23 108 98 CCDS HistoryNCBI Gene:13850Re-query CCDS DB by CCDS ID:88694.1Re-query CCDS DB by GeneID:13850See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 23, NCBI annotation release 108, Ensembl annotation release 98

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 88694.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000224698.1 ENSMUSP00000153161.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000224698.1Link to Ensembl Protein Viewer:ENSMUSP00000153161.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000224698Re-query CCDS DB by Protein ID:ENSMUSP00000153161
Original member Current member NCBI NM_001271403.1 NP_001258332.1 Accepted alive Link to Nucleotide Sequence:NM_001271403.1Link to Protein Sequence:NP_001258332.1Re-query CCDS DB by Nucleotide ID:NM_001271403Re-query CCDS DB by Protein ID:NP_001258332Link to BLAST:NP_001258332.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001258332.1 536 P34914-2 536 100% 0 0

Chromosomal Locations for CCDS 88694.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 66084682 66084760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66084931 66084989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66085296 66085376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66086234 66086303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66086965 66087067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66088300 66088333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66089506 66089580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66092799 66092910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66094738 66094823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66095686 66095712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66098804 66098838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66101593 66101671 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66102147 66102242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66103726 66103794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66107214 66107336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66107977 66108167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66110116 66110275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 66112189 66112320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1611 nt):
ATGCGGTTTGCAGCGATGGCGGCGTTCTCTGTGTTCTTTGTGAGTAAGGGTCTTTTGATGAACTCCAACA
TT
TGGTGTGTTGGCCAGGAAGGCCCTTCTCAGGAGGACACAGACACCATACATACATCAGAGTGGGTACC
A
CTCATGGATGAAAGCTACAGGAAGTCCTCCAAAGCCTGTGGAGCCAATCTACCTGAGAATTTCTCCATA
AGT
CAAATATTCAGCCAAGCTATGGCAGCAAGAAGCATCAACCGCCCCATGCTTCAGGCAGCCATTGCTC
TC
AAAAAGAAAGGATTCACAACATGCATTGTCACCAACAACTGGCTGGACGACGGAGACAAGAGAGACAG
C
CTGGCCCAGATGATGTGTGAGCTGAGCCAACACTTTGACTTCCTGATAGAGTCCTGTCAGGTTGGGATG
ATC
AAGCCTGAGCCTCAGATCTACAATTTTTTACTGGATACCCTGAAGGCAAAACCCAATGAGGTTGTTT
TC
CTAGATGACTTTGGAAGTAATCTGAAGCCAGCCCGTGACATGGGGATGGTTACCATCCTGGTCCACAA
C
ACAGCCTCCGCTCTGAGAGAACTGGAGAAGGTCACAGGGACACAGTTTCCTGAGGCCCCACTGCCAGTC
CCA
TGCAATCCAAATGACGTCAGCCATGGATATGTGACAGTGAAGCCAGGGATCCGCCTGCATTTTGTGG
AG
ATGGGCTCTGGCCCTGCCCTATGCCTTTGCCATGGGTTTCCTGAGAGCTGGTTTTCTTGGAGGTACCA
G
ATCCCTGCTCTGGCCCAGGCAGGCTTTCGTGTTCTGGCTATAGACATGAAAGGCTATGGAGACTCATCT
TCT
CCTCCTGAAATAGAAGAATATGCCATGGAATTGCTGTGTAAGGAGATGGTGACATTCCTGGATAAGC
TG
GGAATCCCTCAAGCAGTGTTCATTGGCCATGACTGGGCTGGTGTGATGGTGTGGAACATGGCTCTCTT
C
TACCCTGAGAGAGTGAGGGCTGTGGCCAGTTTGAACACGCCGTTTATGCCACCAGATCCTGATGTGTCT
CCC
ATGAAAGTTATCCGATCTATCCCAGTTTTCAATTATCAGCTGTACTTTCAAGAACCAGGAGTGGCCG
AG
GCTGAACTGGAGAAGAACATGAGTCGGACTTTCAAAAGCTTCTTCCGAGCCAGTGATGAGACAGGTTT
C
ATCGCTGTGCATAAAGCCACTGAAATAGGGGGAATCCTTGTGAATACTCCAGAAGATCCCAACCTCAGC
AAA
ATTACTACTGAGGAAGAAATAGAGTTTTACATACAGCAGTTCAAGAAGACTGGCTTCAGAGGTCCTC
TG
AACTGGTACCGGAACACAGAAAGAAACTGGAAGTGGAGCTGTAAAGGGTTGGGACGAAAGATCTTGGT
C
CCAGCCCTGATGGTCACAGCTGAGAAGGACATTGTACTCCGTCCTGAAATGTCCAAGAACATGGAAAAG
TGG
ATCCCTTTCCTGAAAAGGGGACACATTGAAGACTGTGGTCACTGGACACAGATAGAGAAACCAACTG
AG
GTGAACCAGATTCTCATCAAGTGGCTGCAGACTGAAGTCCAGAACCCATCAGTGACCTCCAAGATTTA
G


Translation (536 aa):
MRFAAMAAFSVFFVSKGLLMNSNIWCVGQEGPSQEDTDTIHTSEWVPLMDESYRKSSKACGANLPENFSI
S
QIFSQAMAARSINRPMLQAAIALKKK
GFTTCIVTNNWLDDGDKRDSLAQMMCELSQHFDFLIESCQVGM
I
KPEPQIYNFLLDTLKAKPNE
VVFLDDFGSNLKPARDMGMVTILVHNTASALRELEKVTGTQFPEAPLPV
P
CNPNDVSHGYVTVK
PGIRLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAQAGFRVLAIDMKGYGDSS
S
PP
EIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAGVMVWNMALFYPERVRAVASLNTPFMPPDPDVS
P
MKVIRSIPVFNYQLYFQEP
GVAEAELEKNMSRTFKSFFRASDETGFIAVHKATEIGGILVNTPEDPNLS
K
ITTEEEIEFYIQQFKKTGF
RGPLNWYRNTERNWKWSCKGLGRKILVPALMVTAEKDIVLRPEMSKNMEK
W
IPFLKRGHIEDCGHWTQIEKPTEVNQILIKWLQTEVQNPSVTSKI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser