NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS78966.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
78966.1 Public Mus musculus 11 Specc1 23 108 98 CCDS HistoryNCBI Gene:432572Re-query CCDS DB by CCDS ID:78966.1Re-query CCDS DB by GeneID:432572See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 78966.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000202179.1 ENSMUSP00000144300.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000202179.1Link to Ensembl Protein Viewer:ENSMUSP00000144300.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000202179Re-query CCDS DB by Protein ID:ENSMUSP00000144300
Original member Current member NCBI NM_001029936.3 NP_001025107.1 Accepted alive Link to Nucleotide Sequence:NM_001029936.3Link to Protein Sequence:NP_001025107.1Re-query CCDS DB by Nucleotide ID:NM_001029936Re-query CCDS DB by Protein ID:NP_001025107Link to BLAST:NP_001025107.1

Chromosomal Locations for CCDS 78966.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 62077197 62077236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62117700 62119282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62128200 62128407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62131830 62131903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62132276 62132454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62146306 62146451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62147568 62147668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62151870 62151951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62156487 62156640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62161808 62161910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62205384 62205500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62211644 62211703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62219285 62219374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2937 nt):
ATGGGCAACCACTCAGCGAAGCTGGAGGAGCCCGAGACAGGGACTATTCCAACAACTAAACGGACAGGCA
TT
CCAGCTCCACGGGAGCTCTCAGTAACTATCTCCAGAGAGAGGTCTGTGCCACGTGGTCCCTCCAGCTC
A
AAGAAGTTAGGCTCCAGCCCAACTTCTTCCTGCAATCCCACTCCTACCAAGCATCTGAGGACCACCCCT
GCA
AAACCTAAGCAAGAGCATGAAGGTGCAGAGAAGGCTGTGCTCGAGTCCCAGGTACGAGAACTTCTGG
CA
GAAGCCAAAACCAAAGACAGTGAAATCAACAGGCTTCGAAGTGAACTAAAAAAATGCAAAGAGAGGTG
G
GCCCTGAGCACTGAGGATGCCAATGCTTCAGACCCAAGTGCAGAGGGAACAGCATCCCCAGAAAGTGAT
GCA
CAGCCTTTGATAAGAACCCTGGAGGAGAAGAACAAGACCTTTCAGAAAGAGCTTGCTGACCTAGAGG
AA
GAAAACAGGGCCTTGAAGGAGAAACTGACTTACCTTGAGCAGTCACCAAATTCAGAAGGGGCAGCAAG
T
CACACTGGTGACAGCAGCTGCCCAACATCTATAACCCACGAGTCCAGTTTTGGAAGCCCAGTTGGAAAT
GAG
TTGTCTAGTGAAACAGATGAGTACAGAAGAACCACACATGGGAGTGCCTTGCGGACATCAGGGTCTT
CA
AGCAGTGATGTCACCAAAGCCTCTCTGTCACCGGACGCCTCAGATTTTGAGCATATCACTGCAGACAC
C
CCGTCTCGGCCCCTGTCAGCCACTAGCAACCCTTTTAAGAGCTCCAAGGGCTCCCCTACTGGGAGCTCC
CCA
AACAATGCAAGTGAGCTGTCCTTGGCATCTCTCACGGAGAAGATACAGAAGATGGAGGAGAATCAGC
AC
AGCACTGCAGAAGAGCTGCAGGCTACTCTGCAGGAATTATCAGACCAGCAGCAGATGGTGCAGGAACT
G
ACAGCCGAGAACGAGAAGCTAGTGGATGAGAAGACCATTCTGGAGACCTCCTTCCACCAGCACCGAGAG
AGG
GCAGAACAGCTGAGTCAGGAAAATGAGAAGCTGATCAACCTTTTACAGGAGCGAGTGAAGAATGAGG
AA
CCCAGTGCCCAGGGAGGGAAGGTCCTTGAGCTGGAGCAGAAGTGCACGGATATTCTCGAGAAGAGCCG
C
TTTGAAAGAGAGAAGCTGCTCAACATTCAGCAGCAGCTGACCTGTAGCCTACGGAAGGTTGAGGAAGAA
AAC
CAAGGCGCTATAGACATGATTAAGCACCTGAAGGAAGAAAATGAGAAGCTGAATGGGTTCCTAGAAC
AT
GAGCGGTGTAATAATAGTGTGATGGCCAAAACTCTGGAGGAATGTCGAGTTACCTTGGAAGGCTTGAA
A
ATGGAGAATGGGTCCTTGAAGGCTCTTTTGGAGGCTGATAAGCAAAAAGCCATAGAGGCCAGCAGTACT
GTG
GGGCAGACAGCAGAGAACTTCGAGGTTCAGGAGATGCTGAAAGTGGCTCGAGCTGAGAAAGATCAGT
TG
CAGCTGTCTTGCACAGAGCTCAGACAAGAATTGCTAAAGGCAAATGGTGAAATTAAACATGTTTCCAG
C
CTGCTAGCTAAGATGGAGAAAGATTATTCGTACCTGAAAGAAGTCTGTGATCATCAAGCAGAACAGCTG
AGC
AGAACCAGCCTAAAATTACAAGAGAAAGCTTCAGAAAGTGACGCAGAAATCAAAGACATGAAAGAGA
CC
ATATTTGAATTGGAAGACCAGGTGGAGCAGCATCGCGCCGTCAAGTTACACAATAACCAGCTCATCAG
T
GAGCTGGAAGGCAGTGTGATCAAGCTGGAGGAGCAGAAGTCAGACCTAGAGCGGCAGTTAAAGACGCTA
ACA
AAACAGATAAAGGAGGAAACAGAAGAATGGAGGCGATTCCAGGCAGACTTACAGACTGCAGTGGTAG
TG
GCCAACGACATCAAGTGTGAGGCTCAGCAGGAGCTGCGCACTGTGAAGAGGAGGTTGCTGGAGGAGGA
A
GAGAAAAATGCCAGGCTGCAGAAGGAGCTGGGAGACATACAGGGGCACAGCAGACCTGTGAATGAAGAG
CCA
GAGCCCTCAGAGGCCGATGCTGCTGGCCGGTGGCGTGGAGTCTATGTCAACAGAACATCTCCAGCTC
CT
TCAGACTCTGCAACCACAGTAAAGTCACTGATCAAATCATTTGACTTAGGACACTCAGGTGGAACTGG
C
CAGAGTATTTCTGTCCACAAGACTCCCAGAAGCCCCCTGAGTGGAATCCCAGTGAGGACTGCTCCTGCC
GCT
GCTGTCTCTCCGATGCAGAGACATTCAACATACAGCAGCATGAAGCCAGCCAGCAAAGGGACGTCTC
AG
CGCTTGGATCTGCCGGACCTTCCCCTCTCTGATCTGCTGAAGGGAAGGGCCGAGGACCGGAAGTCAGA
C
CCTTACCTCCGAAAGAGTCCCTCACTGGAGTCCCTGAGCAGACCCCCCTCCCTGGGCTTTGGGAACACC
AGA
CTGCTGAGTGCGTCCACCGGGGGTCTGAAGCCAAGCAAGCTCAGTGTTGAAAGAAGAGACCCTCTGG
CA
GCCCTGGCCCGGGAGTATGGTGGCTCTAAGCGTAACGCACTCCTGAAATGGTGTCAGAAGAAGACAGA
A
GGTTATGCGAACATTGATATCACCAATTTCAGCAGCAGCTGGAGTGATGGGCTGGCCCTCTGTGCTCTG
CTG
CACACCTACCTGCCTGCCCACATCCCATACCAGGAATTGAACAGTCAGGAGAAAAAAAGGAATCTCC
TG
TTGGCATTTGAAGCCGCGCAGAGTGTAGGCATCAACCCCAGCCTGGAGCTCAGTGAGATGCTGTACAC
G
GACCGGCCTGACTGGCAGAGCGTGATGCAGTATGTGGCCCAGATCTACAAGTACTTTGAGACATAA


Translation (978 aa):
MGNHSAKLEEPETGTIPTTKRTGIPAPRELSVTISRERSVPRGPSSSKKLGSSPTSSCNPTPTKHLRTTP
A
KPKQEHEGAEKAVLESQVRELLAEAKTKDSEINRLRSELKKCKERWALSTEDANASDPSAEGTASPESD
A
QPLIRTLEEKNKTFQKELADLEEENRALKEKLTYLEQSPNSEGAASHTGDSSCPTSITHESSFGSPVGN
E
LSSETDEYRRTTHGSALRTSGSSSSDVTKASLSPDASDFEHITADTPSRPLSATSNPFKSSKGSPTGSS
P
NNASELSLASLTEKIQKMEENQHSTAEELQATLQELSDQQQMVQELTAENEKLVDEKTILETSFHQHRE
R
AEQLSQENEKLINLLQERVKNEEPSAQGGKVLELEQKCTDILEKSRFEREKLLNIQQQLTCSLRKVEEE
N
QGAIDMIKHLKEENEKLNGFLEHERCNNSVMAKTLEECRVTLEGLKMENGSLKALLEADKQKAIEASST
V
GQTAENFEVQEMLKVARAEKDQLQLSCTELRQELLKANGEIKHVSSLLAK
MEKDYSYLKEVCDHQAEQL
S
RTSLKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKLHNNQLISELE
GSVIKLEEQKSDLERQLKTL
T
KQIK
EETEEWRRFQADLQTAVVVANDIKCEAQQELRTVKRRLLEEEEKNARLQKELGDIQGHSRPVNEE
P
EPSEADAAGRWRGVYVNRTSPAPSDSATTVKSLIKSFDLGHS
GGTGQSISVHKTPRSPLSGIPVRTAPA
A
AVSPMQ
RHSTYSSMKPASKGTSQRLDLPDLPLSDLLKGRAEDRKSDPYLRKSPSLESLSRPPSLGFGNT
R
LLSASTGGLKPSKL
SVERRDPLAALAREYGGSKRNALLKWCQKKTEGYANIDITNFSSSWSDGLALCAL
L
HTYLPAHIPYQELNSQEK
KRNLLLAFEAAQSVGINPSLELSEMLYTDRPDWQSVMQYVAQIYKYFET



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser