NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24933.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24933.1 Public Mus musculus 11 Asgr1 23 108 98 CCDS HistoryNCBI Gene:11889Re-query CCDS DB by CCDS ID:24933.1Re-query CCDS DB by GeneID:11889See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24933.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000018699.12 ENSMUSP00000018699.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018699.12Link to Ensembl Protein Viewer:ENSMUSP00000018699.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000018699Re-query CCDS DB by Protein ID:ENSMUSP00000018699
Original member Current member EBI ENSMUST00000092959.10 ENSMUSP00000090637.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000092959.10Link to Ensembl Protein Viewer:ENSMUSP00000090637.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000092959Re-query CCDS DB by Protein ID:ENSMUSP00000090637
Original member Current member EBI ENSMUST00000146411.8 ENSMUSP00000121842.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000146411.8Link to Ensembl Protein Viewer:ENSMUSP00000121842.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000146411Re-query CCDS DB by Protein ID:ENSMUSP00000121842
Original member Current member NCBI NM_001291131.1 NP_001278060.1 Accepted alive Link to Nucleotide Sequence:NM_001291131.1Link to Protein Sequence:NP_001278060.1Re-query CCDS DB by Nucleotide ID:NM_001291131Re-query CCDS DB by Protein ID:NP_001278060Link to BLAST:NP_001278060.1
Original member Current member NCBI NM_009714.3 NP_033844.1 Accepted alive Link to Nucleotide Sequence:NM_009714.3Link to Protein Sequence:NP_033844.1Re-query CCDS DB by Nucleotide ID:NM_009714Re-query CCDS DB by Protein ID:NP_033844Link to BLAST:NP_033844.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001278060.1 284 P34927 284 100% 0 0
NP_033844.1 284 P34927 284 100% 0 0

Chromosomal Locations for CCDS 24933.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 70054900 70054966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 70055997 70056113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 70056237 70056332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 70056414 70056485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 70056858 70056944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 70057032 70057183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 70057264 70057370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 70057487 70057643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (855 nt):
ATGACAAAGGATTATCAAGATTTCCAGCACCTGGACAATGATAATGACCATCATCAACTCCGGAGAGGGC
CG
CCTCCCACTCCACGGCTCTTGCAGCGACTCTGCTCTGGATCCCGCCTCCTCCTGCTCTCCTCGAGCCT
C
AGCATTCTGTTGCTGGTGGTTGTCTGTGTGATCACATCCCAAAATTCCCAACTCCGGGAAGATCTGCTG
GCT
CTAAGGCAGAATTTCAGCAACCTCACTGTGAGCACTGAGGACCAGGTCAAGGCCCTGAGCACCCAGG
GA
AGTAGTGTGGGAAGAAAGATGAAGTTAGTGGAGTCGAAGCTGGAAAAACAGCAGAAGGATCTGACTGA
A
GATCACTCCAGTTTGCTACTGCACGTGAAGCAGTTAGTGTCTGACGTGCGAAGCTTGAGCTGCCAGATG
GCT
GCATTTCGGGGCAATGGCTCTGAAAGGACCTGCTGCCCCATCAACTGGGTGGAGTATGAAGGCAGCT
GC
TACTGGTTCTCCAGCTCTGTGAGGCCTTGGACTGAAGCTGACAAGTACTGCCAGCTGGAAAATGCCCA
T
CTGGTGGTGGTGACCTCCAGGGATGAGCAGAACTTCCTCCAGCGCCACATGGGCCCCTTAAACACTTGG
ATT
GGCCTAACTGACCAGAACGGGCCCTGGAAATGGGTGGATGGAACAGACTACGAGACAGGCTTCCAGA
AT
TGGAGACCAGAGCAGCCAGATAACTGGTACGGACATGGGCTTGGAGGAGGCGAGGACTGTGCCCACTT
C
ACGACGGATGGCCGCTGGAATGACGACGTCTGCAGGAGGCCCTACCGCTGGGTCTGTGAGACAAAGTTG
GAT
AAGGCTAATTAG


Translation (284 aa):
MTKDYQDFQHLDNDNDHHQLRRGPPPTPRLLQRLCSGSRLLLLSSSLSILLLVVVCVITSQNSQLREDLL
A
LRQNFSNLTVSTEDQVKALSTQ
GSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQM
A
AFRGN
GSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTW
I
GLTDQNGPWKWVDGTDYETGF
QNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKL
D
KAN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser