NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25457.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25457.1 Public Mus musculus 11 Ramp2 23 108 98 CCDS HistoryNCBI Gene:54409Re-query CCDS DB by CCDS ID:25457.1Re-query CCDS DB by GeneID:54409See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25457.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000129680.7 ENSMUSP00000122072.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000129680.7Link to Ensembl Protein Viewer:ENSMUSP00000122072.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000129680Re-query CCDS DB by Protein ID:ENSMUSP00000122072
Original member Current member NCBI NM_019444.2 NP_062317.1 Accepted alive Link to Nucleotide Sequence:NM_019444.2Link to Protein Sequence:NP_062317.1Re-query CCDS DB by Nucleotide ID:NM_019444Re-query CCDS DB by Protein ID:NP_062317Link to BLAST:NP_062317.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062317.1 189 Q9WUP0 189 100% 0 0

Chromosomal Locations for CCDS 25457.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 101246452 101246572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 101247055 101247144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 101247586 101247688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 101247811 101248066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (570 nt):
ATGGCCCCGCTCCGGGTAGAGCGCGCCCCGGGTGGATCTCGGCTTGGTGTGACCCGCGCCCAGCGGCCGA
CA
GCGTTGTGCCTCCCTCCGCTGTTGCTGCTGCTGCTGCTGCTGCTGGGCGCTGTCTCAGCCTCTCCGGA
G
TCCCTGAACCAATCTCTTCCGGAGTCCCAGAATCAATCTCATCCCACTGAGGACAGCCTTGTGTCAAAA
G
GG
AAGATGGAAGACTACGAAACACATGTCCTACCTTGCTGGTATGAGTACAAGAGTTGCATGGACTCTG
TC
AAGGACTGGTGCAACTGGACTTTGATTAGCAGGCATTACAGCGACCTGCAGAACTGCTTGGAATACAA
T
GCAGACAAGTTTGGGCTGGGCTTCCCAAATCCCTTGGCAGAAAACATCATCCTTGAGGCTCACCTGATA
CAC
TTTGCGAACTGCTCCCTGGTGCAGCCCACCTTCTCTGATCCCCCAGAGGATGTGCTCCTGGCCATGA
TC
ATAGCCCCCATCTGCCTCATCCCGTTCCTTGTTACTCTTGTGGTGTGGAGGAGTAAAGACAGCGATGC
C
CAGGCCTAG


Translation (189 aa):
MAPLRVERAPGGSRLGVTRAQRPTALCLPPLLLLLLLLLGAVSASPESLNQSLPESQNQSHPTEDSLVSK
G
KMEDYETHVLPCWYEYKSCMDSVKDWCNWTLISRHYSDLQNCLEYNADKFGLGFPNPLAENIILEAHLI
H
FANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLVTLVVWRSKDSDAQA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser