NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS35942.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35942.1 Public Mus musculus 10 Prmt2 23 108 98 CCDS HistoryNCBI Gene:15468Re-query CCDS DB by CCDS ID:35942.1Re-query CCDS DB by GeneID:15468See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35942.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000020452.11 ENSMUSP00000020452.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020452.11Link to Ensembl Protein Viewer:ENSMUSP00000020452.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000020452Re-query CCDS DB by Protein ID:ENSMUSP00000020452
Original member Current member EBI ENSMUST00000099571.9 ENSMUSP00000097166.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000099571.9Link to Ensembl Protein Viewer:ENSMUSP00000097166.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000099571Re-query CCDS DB by Protein ID:ENSMUSP00000097166
Original member Current member NCBI NM_001077638.2 NP_001071106.1 Accepted alive Link to Nucleotide Sequence:NM_001077638.2Link to Protein Sequence:NP_001071106.1Re-query CCDS DB by Nucleotide ID:NM_001077638Re-query CCDS DB by Protein ID:NP_001071106Link to BLAST:NP_001071106.1
Original member Current member NCBI NM_133182.3 NP_573445.2 Accepted alive Link to Nucleotide Sequence:NM_133182.3Link to Protein Sequence:NP_573445.2Re-query CCDS DB by Nucleotide ID:NM_133182Re-query CCDS DB by Protein ID:NP_573445Link to BLAST:NP_573445.2

Chromosomal Locations for CCDS 35942.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 76207761 76207793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76208412 76208583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76209338 76209474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76210398 76210527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76217314 76217489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76220998 76221162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76222449 76222610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76225288 76225470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76226190 76226315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 76236712 76236765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1338 nt):
ATGGAGGCACCAGGAGAAGGTCCCTGCAGCGAGTCACAGGTCATCCCGGTTCTGGAGGAAGACCCCGTGG
AC
TATGGCTGTGAGATGCAGCTCCTGCAGGATGGGGCACAGTTACAGCTGCAGCTGCAACCTGAGGAGTT
C
GTGGCCATTGCAGACTATACGGCCACCGATGAGACACAGCTCAGCTTTTTGAGAGGAGAAAAAATTCTT
ATC
CTGAGACAAACCACGGCGGACTGGTGGTGGGGCGAGCGCGCAGGCTGCTGTGGTTACATCCCTGCGA
AC
CACCTCGGCAAGCAACTGGAGGAATACGACCCGGAGGACACCTGGCAGGACGAGGAGTACTTCGACAG
C
TATGGAACTCTGAAACTTCACCTGGAAATGTTGGCTGACCAGCCTCGGACCACCAAGTACCACAGCGTC
ATC
CTGCAGAACAAGGAGTCCCTGAAGGACAAGGTCATCCTGGATGTGGGCTGCGGCACCGGCATCATCA
GC
CTCTTCTGCGCACACCATGCCCGGCCCAAGGCGGTCTACGCAGTGGAGGCCAGTGACATGGCCCAGCA
C
ACCAGCCAGCTGGTCCTGCAGAATGGCTTTGCTGACACAATCACTGTGTTCCAGCAGAAGGTGGAGGAC
GTG
GTGCTGCCCGAGAAGGTGGACGTGCTGGTGTCTGAGTGGATGGGGACCTGTCTGCTGTTTGAGTTCA
TG
ATCGAGTCCATCCTGTATGCCCGGGACACATGGTTAAAGGGGGACGGCATCATCTGGCCAACCACGGC
C
GCACTGCATCTGGTGCCCTGCAGCGCCGAGAAAGACTACCACAGCAAGGTGCTCTTCTGGGACAACGCG
TAC
GAGTTCAACCTCAGTGCACTCAAGTCTTTAGCAATCAAGGAGTTCTTTTCAAGGCCAAAGTCGAATC
AT
ATCTTGAAGCCAGAAGACTGTCTCTCTGAGCCATGCACAATCTTGCAGCTGGACATGAGAACTGTGCA
G
GTCCCTGACCTGGAGACCATGCGTGGCGAACTGCGATTTGACATCCAGAAGGCTGGGACCCTGCACGGC
TTC
ACAGCTTGGTTCAGTGTGTACTTCCAGAGCCTGGAGGAGGGCCAGCCTCAGCAGGTGCTCAGCACAG
GC
CCGCTGCACCCCACCACACACTGGAAGCAGACCTTGTTCATGATGGACGACCCAGTCCCGGTCCACAC
G
GGAGATGTGGTCACGGGTTCTGTTGTGTTACAAAGAAATCCGGTATGGAGAAGGCACATGTCTGTCTCT
CTG
AGCTGGGTTGTCACGTCCGCACTCGATCCCACGTCTCAAAGAGTTGGAGAGAAGGTCTTTCCGATCT
GG
AGGTGA


Translation (445 aa):
MEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPEEFVAIADYTATDETQLSFLRGEKIL
I
LRQTTADWWWGERAGCCGYIPANHLGKQLEEYDPEDTWQDEEYFDSYGTL
KLHLEMLADQPRTTKYHSV
I
LQNKESLKDKVILDVGCGTGIISLFCAHHARPKA
VYAVEASDMAQHTSQLVLQNGFADTITVFQQKVED
V
VLPEKVDVLVSEWMGTCLL
FEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNA
Y
EFNLSAL
KSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHG
F
TAWFSVYFQSLEEGQPQQVLSTGPLH
PTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVS
L
SWVVTSALDPTSQR
VGEKVFPIWR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser