NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS20730.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20730.1 Public Mus musculus 7 Ttyh1 23 108 98 CCDS HistoryNCBI Gene:57776Re-query CCDS DB by CCDS ID:20730.1Re-query CCDS DB by GeneID:57776See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 20730.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000119661.7 ENSMUSP00000113937.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000119661.7Link to Ensembl Protein Viewer:ENSMUSP00000113937.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000119661Re-query CCDS DB by Protein ID:ENSMUSP00000113937
Original member Current member EBI ENSMUST00000129423.7 ENSMUSP00000120182.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000129423.7Link to Ensembl Protein Viewer:ENSMUSP00000120182.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000129423Re-query CCDS DB by Protein ID:ENSMUSP00000120182
Original member Current member NCBI NM_001109765.2 NP_001103235.1 Accepted alive Link to Nucleotide Sequence:NM_001109765.2Link to Protein Sequence:NP_001103235.1Re-query CCDS DB by Nucleotide ID:NM_001109765Re-query CCDS DB by Protein ID:NP_001103235Link to BLAST:NP_001103235.1
Original member Current member NCBI NM_021324.6 NP_067299.2 Accepted alive Link to Nucleotide Sequence:NM_021324.6Link to Protein Sequence:NP_067299.2Re-query CCDS DB by Nucleotide ID:NM_021324Re-query CCDS DB by Protein ID:NP_067299Link to BLAST:NP_067299.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001103235.1 450 Q9D3A9-1 450 100% 0 0
NP_067299.2 450 Q9D3A9-1 450 100% 0 0

Chromosomal Locations for CCDS 20730.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 4119655 4119780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4122477 4122655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4124620 4124731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4125523 4125743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4128170 4128265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4129301 4129373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4129658 4129733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4130581 4130636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4130797 4130889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4131291 4131383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4133075 4133217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4133357 4133402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 4133663 4133701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1353 nt):
ATGGGGGCACCCCCGGGCTACCGACCCTCTGCCTGGGTGCATCTCCTCCACCAGCTGCCCCGCGCCGACT
TC
CAGCTCCGCCCGGTGCCCAGCGGCTTTGCTCCCCGCGACCAAGAGTACCAGCAGGCCCTGCTGCTGGT
G
GCAGCCTTGGCTGGGCTTGGTTTAGGCCTGAGCCTCATCTTCATCGCTGTCTACCTCATCCGCTTCTGC
TGC
TGCAGGCCTCCAGAACCCCATGGGGCCAAGAGTCCCCCACCCGGAGGAGGTTGCGTCACCTGGAGCT
GC
ATTGCTGCCCTTCTCGTGGGCTGTGCCGGCATTGGCATTGGTTTCTATGGTAACAGCGAGACCAGCGA
T
GGGGTGTCCCAGCTCAGCTCAGCACTGCTGCACGCCAACCACACGCTCAGCACCATCGATGACGTGGTG
CTG
GAAACGGTGGAGAGGCTGGGTGAGGCAGTGAAGACGGAGCTGACCACCCTGGAGGAAGTGCTGTCAG
TC
CGCATGGAGCTGGTGGCTGCCACCAGGGGAGCCCGAAGGCAGGCTGAAGCTGCTGCTCAGTACCTGCA
A
GGACTGGCCTTCTGGCAAGGAGTGTCCCTGAGCCCCGTACAGGTGGCTGAAGATGTGACTTTCGTGGAG
GAG
TACAGGTGGCTGGCCTATGTCCTCCTGCTGCTCTTGGTGCTTCTGGTTTGTCTCTTCACCCTCCTGG
GC
CTGGCAAAGCAGAGCAAATGGCTGGTGGTTGTGATGACTGCCATGAGTCTCCTGGTGCTTGTCCTGAG
C
TGGGGTTCTATGGGCCTAGAGGCTGCCACAGCTGTGGGCCTCAGTGACTTCTGCTCCAACCCAGACACC
TAT
GTGCTGAACCTGACCCAGGAGGAGACAGGGCTCAGCTCAGACATCCTCAGCTATTATTTCCTGTGCA
AC
CAGGCGGTCTCCAACCCCTTCCAACAGAGGCTGACGCTGTCCCAGCGTGCTCTAGCCAGCATCCACTC
T
CAGCTGCAGGGCCTGGAGCGGGAAGCTATCCCTCAATTTTCTGCTGCACAGAAGCCCTTGTTATCCTTG
GAG
GAGACACTGAATGTGACAGAAAGAAGCTTCCACCAGTTGGTGGCGCTGCTGCACTGCCGCAGTCTGC
AC
AAGGACTATGGCTCAGCACTCCGAGGCCTGTGTGAAGATGCCCTAGAGGGCCTACTGTTCCTGATGCT
C
TTTTCTCTCCTGTCTGCGGGGGCCCTAGCCACCACTCTGTGCAGCCTGCCCCGCGCCTGGGCCCTCTTC
CCA
CCCAGTGATGACTACGATGACACAGATGACGATGACCCTTTCAACCCTCAGGAATCCAAACGCTTTG
TG
CAGTGGCAGTCTTCCATCTGA


Translation (450 aa):
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFC
C
CRPPEPHGAKSPPPGGGCVTWSCIAALLVG
CAGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDDVV
L
ETVERLGEAVKTELTTLEEVLSVRMELVAATRGARRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVE
E
Y
RWLAYVLLLLLVLLVCLFTLLGLAKQSKWLVVVMTAMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDT
Y
VLNLTQEETGLSS
DILSYYFLCNQAVSNPFQQRLTLSQRALASIHSQLQGLEREAIPQFSAAQKPLLSL
E
ETLNVTERSFHQLVALLHCRSLHK
DYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALF
P
P
SDDYDDTDDDDPFNPQESKRFVQWQSSI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser