NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS39142.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39142.1 Public Mus musculus 5 Rassf6 23 108 98 CCDS HistoryNCBI Gene:73246Re-query CCDS DB by CCDS ID:39142.1Re-query CCDS DB by GeneID:73246See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39142.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000031317.9 ENSMUSP00000031317.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031317.9Link to Ensembl Protein Viewer:ENSMUSP00000031317.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000031317Re-query CCDS DB by Protein ID:ENSMUSP00000031317
Original member Current member EBI ENSMUST00000202704.3 ENSMUSP00000144532.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000202704.3Link to Ensembl Protein Viewer:ENSMUSP00000144532.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000202704Re-query CCDS DB by Protein ID:ENSMUSP00000144532
Original member Current member NCBI NM_028478.3 NP_082754.2 Accepted alive Link to Nucleotide Sequence:NM_028478.3Link to Protein Sequence:NP_082754.2Re-query CCDS DB by Nucleotide ID:NM_028478Re-query CCDS DB by Protein ID:NP_082754Link to BLAST:NP_082754.2

Chromosomal Locations for CCDS 39142.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 90603873 90603948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90604043 90604140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90604246 90604364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90606415 90606466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90606776 90606877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90608799 90608992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90609715 90609812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90615795 90615937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90617707 90617785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90631508 90631572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1026 nt):
ATGACAGCAATGGATCACCAGTTCCCTTCTTGGATCGTTGTCAATGAGAGCACATCCATAAGCAGGGAAC
AA
CTCAATTATTTACTGGAGACTTATAATGTTTTCTATGAAAACCAGAAAAATCTGCATATACTGTATGG
G
CAGACCGAAGACGGACAGCTGATTGTTGAAGGGATGCTGGACATTTTCTGGGGAGTCAAACGACCCATA
CAG
CTGAAAATACAAGATGAGAAGCAAATCTCTTCCTTTGATCTGTTGAACACACCGGAAACCTTTTCCA
GC
AAAGGGAGGATGACTCGCTGGGGAGAATTTGATGACCTTTACCGTATCAGCGAGCTGGACAGGACCCA
T
GTTCTAGCATCTGAAGCCAGGCATTCCCCGGAAGACTATTTATCTTACCACAGCACTCTGACACCATAC
GCA
GACGAAGAGCCGGAATCCCCATTGCTCTACAGGACCATGAGTGAGGCAGCTTTGGTGAGAAAAAGGA
TG
AGGGCCCCAGAGATGTACAGAAAAGATAGAATGGGGGTGCTAAGTAACCACAGAGCCTCTATCAACGG
A
CACGTCTATGACCATGAGACATCCATCTTCACCCCAACTTTCGGATCAGAGACTAAGGTCAGAGCCAAT
AGT
ATCATGAGAACTGAAGAAGTAATAAAGCAACTTCTCCAGAAATTTAAGATTGAGAATAGCCCTCGGG
AT
TTCGCTCTTTACATTATTTTTGGGACAGGAGAGCAGAGAAAGCTAAAGAAGACCGATGTCCCACTGCT
G
CAGAGGTTACTACAAGGACCATCCAAAAGCAATGCTCGGATCTTCCTCATGGATAAAGATGCAGAAGAA
ATC
AGCAGAGATGTGGCTCCGTACATTAATTTTCACTTTTCTTTCTTGGAATCCATCCTTCAAAGATTAG
AT
GAAGAAGAGAAAATGGAGATTGAGAGAATTATGGCAAAATTCAATACCGAAAGGGCCTTTATCCTGAA
G
TGTCTACAGAGTAAACAGGCAGCTAAAACGGAGACCACAGTCTAG


Translation (341 aa):
MTAMDHQFPSWIVVNESTSISREQLNYLLETYNVFYENQKNLHILYGQTEDGQLIVEGMLDIFWGVKRPI
Q
LKIQDEKQISSFDLLNTPETFSSK
GRMTRWGEFDDLYRISELDRTHVLASEARHSPEDYLSYHSTLTPY
A
DEEPESPLLYRTMSEAALVRKRMRAPEMYRKDRMGVLSNHRASINGHVYDHE
TSIFTPTFGSETKVRAN
S
IMRTEEVIKQLLQKFK
IENSPRDFALYIIFGTGEQRKLKKTDVPLLQRLLQGPSKSNARIFLMDKDAEE
I
SRD
VAPYINFHFSFLESILQRLDEEEKMEIERIMAKFNTERAFILKCLQSKQAAKTETTV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser