NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS17718.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17718.1 Public Mus musculus 3 Chil3 23 108 98 CCDS HistoryNCBI Gene:12655Re-query CCDS DB by CCDS ID:17718.1Re-query CCDS DB by GeneID:12655See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17718.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000063062.8 ENSMUSP00000053923.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063062.8Link to Ensembl Protein Viewer:ENSMUSP00000053923.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000063062Re-query CCDS DB by Protein ID:ENSMUSP00000053923
Original member Current member NCBI NM_009892.3 NP_034022.2 Accepted alive Link to Nucleotide Sequence:NM_009892.3Link to Protein Sequence:NP_034022.2Re-query CCDS DB by Nucleotide ID:NM_009892Re-query CCDS DB by Protein ID:NP_034022Link to BLAST:NP_034022.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034022.2 398 O35744 398 100% 0 0

Chromosomal Locations for CCDS 17718.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 106147853 106147872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106148579 106148720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106148802 106148921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106149712 106149897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106150118 106150241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106155668 106155792 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106160368 106160533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106161174 106161230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106164090 106164291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106164803 106164832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 106167497 106167521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1197 nt):
ATGGCCAAGCTCATTCTTGTCACAGGTCTGGCAATTCTTCTGAACGTACAGCTGGGATCTTCCTACCAGC
TG
ATGTGCTACTATACCAGTTGGGCTAAGGACAGGCCAATAGAAGGGAGTTTCAAACCTGGTAATATTGA
C
CCCTGCCTGTGTACTCACCTGATCTATGCCTTTGCTGGAATGCAGAATAATGAGATCACTTACACACAT
GAG
CAAGACTTGCGTGACTATGAAGCATTGAATGGTCTGAAAGACAAGAACACTGAGCTAAAAACTCTCC
TG
GCCATTGGAGGATGGAAGTTTGGACCTGCCCCGTTCAGTGCCATGGTCTCTACTCCTCAGAACCGTCA
G
ATATTCATTCAGTCAGTTATCAGATTCCTTCGTCAATATAACTTTGATGGCCTCAACCTGGACTGGCAG
TAC
CCTGGGTCTCGAGGAAGCCCTCCTAAGGACAAACATCTCTTCAGTGTTCTGGTGAAGGAAATGCGTA
AA
GCTTTTGAGGAAGAATCTGTGGAGAAAGACATTCCAAGGCTGCTACTCACTTCCACAGGAGCAGGAAT
C
ATTGACGTAATCAAGTCTGGGTACAAGATCCCTGAACTGTCTCAGTCTCTTGACTATATTCAGGTCATG
ACA
TATGATCTCCATGATCCTAAGGATGGCTACACTGGAGAAAATAGTCCCCTCTATAAATCTCCATATG
AC
ATTGGAAAGAGTGCTGATCTCAATGTGGATTCAATCATTTCCTACTGGAAGGACCATGGAGCAGCTTC
T
GAGAAGCTCATTGTGGGATTTCCAGCATATGGGCATACCTTTATCCTGAGTGACCCTTCTAAGACTGGA
ATT
GGTGCCCCTACAATTAGTACTGGCCCACCAGGAAAGTACACAGATGAATCAGGACTCCTGGCTTACT
AT
GAGGTTTGTACATTTCTGAATGAAGGAGCCACTGAGGTCTGGGATGCCCCCCAGGAAGTACCCTATGC
C
TATCAGGGTAATGAGTGGGTTGGTTATGACAATGTCAGGAGCTTCAAGTTGAAGGCTCAGTGGCTCAAG
GAC
AACAATTTAGGAGGTGCCGTGGTCTGGCCCCTGGACATGGATGACTTCAGTGGTTCTTTCTGTCACC
AG
AGACATTTCCCTCTGACATCTACTTTAAAGGGAGATCTCAATATACACAGTGCAAGTTGCAAGGGCCC
T
TATTGA


Translation (398 aa):
MAKLILVTGLAILLNVQLGSSYQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTH
E
QDLRDYEALNGLKD
KNTELKTLLAIGGWKFGPAPFSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQ
Y
PGSRGSPPKDKHLFSVLVK
EMRKAFEEESVEKDIPRLLLTSTGAGIIDVIKSGYKIPELSQSLDYIQVM
T
YDLHDPKDGYTGENSPLYKSPYDIGKSADLNV
DSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSKTG
I
GAPTISTGPPGKYTDESGLLAYYE
VCTFLNEGATEVWDAPQEVPYAYQGNEWVGYDNVRSFKLKAQWLK
D
NNLGGAVVWPLDMDDFSGSFCHQRHFPLTSTLKGDLNIHSA
SCKGPY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser