NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS39504.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39504.1 Public Mus musculus 6 Rpia 23 108 98 CCDS HistoryNCBI Gene:19895Re-query CCDS DB by CCDS ID:39504.1Re-query CCDS DB by GeneID:19895See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39504.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000066134.5 ENSMUSP00000064158.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066134.5Link to Ensembl Protein Viewer:ENSMUSP00000064158.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000066134Re-query CCDS DB by Protein ID:ENSMUSP00000064158
Original member Current member NCBI NM_009075.2 NP_033101.2 Accepted alive Link to Nucleotide Sequence:NM_009075.2Link to Protein Sequence:NP_033101.2Re-query CCDS DB by Nucleotide ID:NM_009075Re-query CCDS DB by Protein ID:NP_033101Link to BLAST:NP_033101.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033101.2 303 P47968 303 100% 0 0

Chromosomal Locations for CCDS 39504.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 70766554 70766648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70770994 70771093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70773430 70773571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70774251 70774319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70775109 70775173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70777352 70777411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70783561 70783616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70785545 70785605 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 70791886 70792149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (912 nt):
ATGCAGCGCCCCGGGCCCTTCAGCACCCTCTACGGGCGGGTCCTGGCCCCACTGCCCGGGCGGGCCGGGG
GC
GCGGCCTCGGGCGGGGGCGGGAACAACTGGGGCCTCTCGGGTTCCCACGTGCAGTTGCCGGGGCGTGC
A
CATTCGGAGACCCGCGGCGACAAGGGAGGCTCGAGCGCGGGCGGCCCGGCCCCCTCCACGATGTCCAAG
GCC
GAGGAGGCTAAGAAGCTGGCGAGCCACACGGCGGTGGAGAACCACGTGAAGAATAACCAAGTGCTGG
GA
ATTGGAAGTGGTTCTACAATTGTCCACGCTGTGCAGCGAATAGCTGAAAGAGTGAAGCAAGAGAATCT
G
GACCTCATCTGCATCCCCACATCTTTCCAGGCCAGGCAGCTTATCTTGCAGTATGGCTTAACCCTCAGT
GAC
CTGGATCAACACCCAGAGATTGACCTTGCCATCGATGGTGCTGACGAAGTGGATGCTGAGCTCAATC
TC
ATCAAGGGTGGAGGAGGCTGCCTGACCCAGGAGAAGATCGTGGCTGGTTATGCAAGTCGTTTCATTGT
G
ATTGCTGATTTCAGGAAAGATTCAAAGAACCTCGGGGATCGGTGGCACAAGGGGATTCCCATTGAAGTC
ATC
CCAATGGCCTACGTCCCAGTGAGCCGGGCTGTGGCCCAGAAGTTTGGGGGTGAGGTGGAACTTCGAA
TG
GCTGTCAACAAGGCAGGGCCAGTGGTGACGGATAACGGGAATTTTATCCTGGACTGGAAGTTTGACCG
G
GTGCATAAATGGAGTGAAGTGAACACAGCTATCAAAATGACTCCAGGCGTGGTGGACACAGGCCTTTTC
ATC
AACATGGCAGAGAGAGTCTACTTTGGGATGCAGGATGGCTCAGTGAACGTGCGGGAGAAGCCCTTCT
AG


Translation (303 aa):
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNNWGLSGSHVQLPGRAHSETRGDKGGSSAGGPAPSTMSK
A
EEAKKLASHTAVENHVK
NNQVLGIGSGSTIVHAVQRIAERVKQENLDLICIPTSFQARQLILQYGLTLS
D
LDQHPE
IDLAIDGADEVDAELNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDRWHKGIPIEV
I
PMAYVPVSRAVAQKFGGEVELRMAVNKA
GPVVTDNGNFILDWKFDRVHKWSEVNTAIKMTPGVVDTGLF
I
NMAERVYFGMQDGSVNVREKPF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser