NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS83946.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
83946.1 Public Mus musculus 11 Pcyt2 23 108 98 CCDS HistoryNCBI Gene:68671Re-query CCDS DB by CCDS ID:83946.1Re-query CCDS DB by GeneID:68671See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 21, NCBI annotation release 106, Ensembl annotation release 86

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 83946.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000106188.3 ENSMUSP00000101794.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106188.3Link to Ensembl Protein Viewer:ENSMUSP00000101794.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000106188Re-query CCDS DB by Protein ID:ENSMUSP00000101794
Original member Current member NCBI NM_001347615.2 NP_001334544.1 Accepted alive Link to Nucleotide Sequence:NM_001347615.2Link to Protein Sequence:NP_001334544.1Re-query CCDS DB by Nucleotide ID:NM_001347615Re-query CCDS DB by Protein ID:NP_001334544Link to BLAST:NP_001334544.1

Chromosomal Locations for CCDS 83946.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 120610669 120610771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120610876 120610964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120611113 120611178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120611348 120611413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120611628 120611705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120612001 120612083 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120612463 120612601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120613379 120613423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120613641 120613725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120614331 120614397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120615291 120615452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120615849 120615937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 120617764 120617852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1161 nt):
ATGATCCGGAACGGGCACGGGGCTGCCAGCGCTGCTGGGCTGAAGGGTCCGGGAGATCAGCGCATCGTGC
GG
GTGTGGTGCGATGGCTGCTATGACATGGTGCATTATGGCCACTCCAACCAGCTACGGCAGGCACGGGC
C
ATGGGGGACTACCTCATCGTGGGTGTGCATACGGATGAGGAGATTGCCAAGCATAAGGGGCCCCCGGTG
TTT
ACCCAGGAGGAGAGGTACAAGATGGTACAGGCCATCAAGTGGGTGGATGAGGTGGTGCCCGCTGCTC
CC
TACGTCACCACCCTGGAGACACTGGACAAGCACAACTGTGACTTCTGTGTTCACGGCAATGACATCAC
G
CTGACAGTAGACGGCCGAGACACCTATGAGGAAGTGAAGCAGGCTGGGAGGTACAGAGAGTGCAAACGC
ACC
CAGGGTGTGTCCACCACAGACCTCGTGGGTCGCATGCTGCTGGTGACCAAGGCCCATCACAGCAGCC
AG
GAGATGTCCTCTGAGTACCGGGAATATGCTGACAGTTTTGGAAAGTGCCCTGGGGGGCAGAGCCCCTG
G
ACAGGGGTGTCCCAGTTTCTACAGACATCCCAGAAGATCATCCAGTTTGCTTCTGGGAAGGAGCCCCAG
CCC
GGGGAGACGGTCATCTATGTGGCTGGTGCCTTTGACCTGTTCCACATCGGGCACGTGGACTTCCTAC
AG
GAGGTGCACAAGCTAGCCAAGAGGCCCTACGTCATCGCCGGCCTACACTTTGACCAGGAAGTAAACCG
G
TACAAGGGCAAGAACTACCCCATCATGAACCTGCACGAGCGGACTCTCAGTGTGCTGGCCTGCCGGTAT
GTT
TCAGAAGTGGTGATTGGGGCACCATACTCCGTGACAGCGGAGCTCCTGAATCACTTCAAGGTGGACC
TG
GTGTGTCACGGGAAGACAGAGATTGTACCCGACAGGGATGGGTCTGACCCCTACCAGGAGCCCAAGAG
A
AGAGGCATCTTCTATCAGATTGACAGTGGCAGTGACCTCACTACAGACCTGATTGTGCAGAGGATCATC
AAG
AACAGGCTGGAGTATGAAGCACGGAATCAGAAGAAAGAAGCCAAGGAATTAGCCTTTCTGGAGGCCA
CG
AAGCAGCAGGAGGCGCCGCCTGGAGGGGAGATTGACTAG


Translation (386 aa):
MIRNGHGAASAAGLKGPGDQRIVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPV
F
TQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKHNCDFCVHG
NDITLTVDGRDTYEEVKQAGRYRECKR
T
QGVSTTDLVGRMLLVTKAHHSSQ
EMSSEYREYADSFGKCPGGQSPWTGVSQFLQTSQKIIQFASGKEPQ
P
GETVIYVAGAFDLF
HIGHVDFLQEVHKLAKRPYVIAGLHFDQEVNRYKGKNYPIMNLHERTLSVLACRY
V
SEVVIGAPYSVTAELLNHFK
VDLVCHGKTEIVPDRDGSDPYQEPKRRGIFYQIDSGSDLTTDLIVQRII
K
N
RLEYEARNQKKEAKELAFLEATKQQEAPPGGEID



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser