NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28153.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28153.1 Public Mus musculus 16 Stfa3 23 108 98 CCDS HistoryNCBI Gene:20863Re-query CCDS DB by CCDS ID:28153.1Re-query CCDS DB by GeneID:20863See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 28153.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000068182.2 ENSMUSP00000067445.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000068182.2Link to Ensembl Protein Viewer:ENSMUSP00000067445.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000068182Re-query CCDS DB by Protein ID:ENSMUSP00000067445
Original member Current member NCBI NM_025288.2 NP_079564.1 Accepted alive Link to Nucleotide Sequence:NM_025288.2Link to Protein Sequence:NP_079564.1Re-query CCDS DB by Nucleotide ID:NM_025288Re-query CCDS DB by Protein ID:NP_079564Link to BLAST:NP_079564.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079564.1 103 P35173 103 100% 0 0

Chromosomal Locations for CCDS 28153.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 36450609 36450734 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 36452151 36452252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 36455281 36455364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (312 nt):
ATGAGTCAAGAAAACTTAAAAATAAAGGGAGGCCTGTCAGAGGCCAGACCTGCCACACCAGAAATCCAGA
TG
ATTGCTGACAAGGTCAGACCTCTGCTTGAAGAGCAAACCAATGAGAAATATGAAAAATTCGAGGCTGT
C
GAGTATAAATCTCAAGTCGTTGCTGGACAAAATTTGTTCATTAAGATAGATGTAGGGAATGGTTGTTTC
CTT
CACATGAAAGTCTTCAGAGGCCTTTCTGGAGAAGATGATTTGAAACTTAAGGGTTACCAGACTAACA
AA
ACCAAGACTGATGAGCTGACCTCCATGTAA


Translation (103 aa):
MSQENLKIKGGLSEARPATPEIQMIADKVRPLLEEQTNEKYEKFEAVEYKSQVVAGQNLFIKIDVGNGCF
L
HMKVFRGLSGEDDLKLKGYQTNKTKTDELTSM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser