NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS90110.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
90110.1 Public Mus musculus 6 Rasgef1a 23 108 98 CCDS HistoryNCBI Gene:70727Re-query CCDS DB by CCDS ID:90110.1Re-query CCDS DB by GeneID:70727See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 23, NCBI annotation release 108, Ensembl annotation release 98

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 90110.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000203804.2 ENSMUSP00000145214.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000203804.2Link to Ensembl Protein Viewer:ENSMUSP00000145214.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000203804Re-query CCDS DB by Protein ID:ENSMUSP00000145214
Original member Current member NCBI NM_001362103.1 NP_001349032.1 Accepted alive Link to Nucleotide Sequence:NM_001362103.1Link to Protein Sequence:NP_001349032.1Re-query CCDS DB by Nucleotide ID:NM_001362103Re-query CCDS DB by Protein ID:NP_001349032Link to BLAST:NP_001349032.1

Chromosomal Locations for CCDS 90110.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 118066445 118066462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118080358 118080561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118083014 118083136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118084421 118084558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118085237 118085485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118085773 118085847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118086217 118086309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118087027 118087129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118087207 118087286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118088109 118088300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118089103 118089226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118089435 118089507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 118089816 118089840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1497 nt):
ATGTTTCTGGAGCCCCAGGAAGCTATGCCCCAGACATCTGTGGTCTTCTCCAGCATCCTTGGGCCCAACT
GT
AACAGACAGGTGCAGCCTGGCATGGGGGAGAGAGGAGGTGGGGCCAGCAGCGGCTCCAAGGACCTCAT
T
TTTCAAGATGGACGCCTCACTTCTGGGTCCTTGGAGGCCTTGATGGAGCATCTGGTTCCAACGGTGGAC
TAT
TATCCTGATCGGACATACATCTTCACGTTTCTCCTGAGTTCCCGGGTCTTCATGCCCCCTCATGACC
TT
CTGGCTCGAGTAGGGCAGATCTGCCTGGAGCAGAGGCAACAGCTAGAGGCTGGGCCTGAGAAGGCCAA
G
CTGAAGTCCTTCTCGACCAAGATTGTGCAGCTGTTGAAGGAGTGGACGGAGGCCTTCCCTTATGACTTC
CAG
GACGAGAAGGTCATGGCGGAGCTGAAGGCCATCGCACACCGCGTCACTCAGTGTGATGAGTACCTGA
TG
CAGCCCCGACCCTCACAGGAGAATGGCACAGTGAAGAAAGCCATTGCCCAAATGATACAAAGCTTGCT
G
CTGTCCCTGGCTGCCCGAAGTCAGCTCCAAGAGCTTCGGGAGAAGCTCCGGTCACCCGTTGTGGACAAA
GGG
CCTGTCCTTAAGGCCAAGCCACCAGCTGCCCAGAAAGACATCCTGGGTGTGTGCAGCGACCCCCTGG
TG
CTGGCCCAGCAGCTGACTCACATTGAACTGGAACGGGTCAACAGCATCCGCCCTGAGGACCTGATGCA
G
ATCATCAGCCACATGGACTCTCTGGACAATCACAGGTGCCGTGGAGACATGACTAAGACCTTCAGTTTA
GAA
GCGTATGACAACTGGTTCAACTGCTTGAGCATGCTCGTGGCTACAGAGGTGTGCCGGGTGGTAAAGA
AG
AAACACCGGACCCGCATGCTGGAGTTCTTCATTGATGTGGCCCGAGAGTGTTTCAACATCGGGAACTT
C
AACTCTATGATGGCCATCATATCTGGCATGAACCTCAGCCCAGTGGCACGGCTGAAGAAAACGTGGTCC
AAA
GTCAAGACAGCCAAGTTTGATGTCTTGGAGCATCACATGGACCCCTCCAGCAACTTCTGCAACTACC
GG
ACAGCCCTGCAGGGGGCGACACAGAGATCCCAGACAGCCAACAGCAGCCGTGAGAAGATTGTCATCCC
C
GTGTTCAACCTCTTCGTTAAGGACATCTACTTTCTACACAAAATCCACACCAACCACCTACCCAATGGG
CAC
ATTAACTTCAAAAAATTTTGGGAAATTTCCAGACAGATCCACGAGTTCATGACATGGACACAGGTAG
AA
TGTCCCTTTGAGAAGGACAAGAAGATTCAGAGTTACGTGCTCACGGCGCCCATCTACAGCGAGGAAGC
T
CTCTTCATCGCCTCCTTTGAAAGTGAAGGTCCTGAAAATCACATGGAGAAGGACAGCTGGAAGGCACTC
AG
G
ACCACTCTCCTTAACAGAGCCTGA


Translation (498 aa):
MFLEPQEAMPQTSVVFSSILGPNCNRQVQPGMGERGGGASSGSKDLIFQDGRLTSGSLEALMEHLVPTVD
Y
YPD
RTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFSTKIVQLLKEWTEAFPYDF
Q
DEKVMAELKAIAHRVTQCDE
YLMQPRPSQENGTVKKAIAQMIQSLLLSLAARSQLQELREKLRSPVVDK
G
PVLKAKPPAAQKDILGVCSDPLVLAQQLTHIEL
ERVNSIRPEDLMQIISHMDSLDNHRCRGDMTKTFSL
E
AYDNWFNCLSMLVATEVCR
VVKKKHRTRMLEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWS
K
VKTAKFDVLE
HHMDPSSNFCNYRTALQGATQRSQTANSSREKIVIPVFNLFVKDIYFLHKIHTNHLPNG
H
INFK
KFWEISRQIHEFMTWTQVECPFEKDKKIQSYVLTAPIYSEEALFIASFESEGPENHMEKDSWKAL
R
TTLLNRA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser