NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS51655.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51655.1 Public Mus musculus 5 Asl 23 108 98 CCDS HistoryNCBI Gene:109900Re-query CCDS DB by CCDS ID:51655.1Re-query CCDS DB by GeneID:109900See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51655.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000159619.7 ENSMUSP00000123799.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000159619.7Link to Ensembl Protein Viewer:ENSMUSP00000123799.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000159619Re-query CCDS DB by Protein ID:ENSMUSP00000123799
Original member Current member EBI ENSMUST00000161094.7 ENSMUSP00000124274.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000161094.7Link to Ensembl Protein Viewer:ENSMUSP00000124274.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000161094Re-query CCDS DB by Protein ID:ENSMUSP00000124274
Original member Current member EBI ENSMUST00000160129.7 ENSMUSP00000124579.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160129.7Link to Ensembl Protein Viewer:ENSMUSP00000124579.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000160129Re-query CCDS DB by Protein ID:ENSMUSP00000124579
Original member Current member NCBI NM_133768.5 NP_598529.1 Accepted alive Link to Nucleotide Sequence:NM_133768.5Link to Protein Sequence:NP_598529.1Re-query CCDS DB by Nucleotide ID:NM_133768Re-query CCDS DB by Protein ID:NP_598529Link to BLAST:NP_598529.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598529.1 464 Q91YI0 464 100% 0 0

Chromosomal Locations for CCDS 51655.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 130011556 130011700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130011865 130011971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130012050 130012130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130012657 130012740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130012997 130013056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130013169 130013253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130013401 130013515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130013963 130014025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130014679 130014731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130016097 130016174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130016296 130016373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130018310 130018407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130018548 130018604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130018833 130018916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130019662 130019856 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 130024042 130024053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1395 nt):
ATGGCATCAGAGAGCGGGAAGCTATGGGGTGGCCGGTTTGTGGGTGCTGTCGACCCCATCATGGAGAAGT
TC
AACTCATCTATCTCCTATGACCGGCATCTGTGGAATGTGGATGTGCAGGGGAGCAAGGCCTACAGCAG
G
GGCCTGGAGAAGGCGGGGCTTCTCACCAAAGCCGAGATGCAGCAGATACTGCAAGGGTTGGACAAGGTT
GCT
GAAGAGTGGGCCCAAGGCACCTTCAAATTACATCCTAATGATGAAGACATCCACACAGCCAACGAGC
GG
CGCCTGAAGGAACTCATCGGTGAAGCTGCAGGGAAGCTACACACAGGACGAAGTCGCAACGACCAGGT
G
GTCACGGACCTCAGGCTGTGGATGAGGCAGACCTGCTCAAAACTCTCCGCCCTCCTCCGGGTGCTCATT
GGA
ACCATGGTCGACCGGGCAGAGGCGGAACGTGATGTCCTCTTCCCAGGGTACACACACTTGCAGAGAG
CT
CAGCCCATTCGCTGGAGCCACTGGATCCTGAGCCACGCTGTTGCGCTGACACGAGATTCAGAGAGACT
C
TTGGAGGTGCAGAAGCGGATCAATGTCTTGCCACTGGGGAGTGGGGCCATTGCAGGCAACCCTCTGGGT
GTG
GACCGGGAGCTACTCCGTGCAGAACTGAACTTTGGGGCCATCACTCTCAACAGCATGGATGCCACCA
GT
GAGAGAGACTTTGTGGCTGAGTTCCTGTTTTGGGCTTCTCTGTGTATGACCCACCTCAGCAGGATGGC
A
GAGGACCTAATTCTCTATGGTACCAAGGAATTCAGCTTTGTGCAACTCTCAGATGCCTACAGCACCGGA
AGC
AGCTTGATGCCCCAGAAGAAAAACCCAGACAGCCTGGAGCTGATCCGGAGCAAGGCGGGCCGAGTGT
TT
GGACGGTGTGCCGGACTCCTGATGACCCTCAAGGGACTTCCAAGCACCTACAACAAGGACTTACAGGA
A
GACAAGGAGGCTGTGTTTGAAGTGTCTGACACCATGATAGCTGTCCTCCAAGTGGCCACTGGAGTCATC
TCT
ACATTGCAGATTCATCGTGAGAACATGAAACAGGCGCTCAGCCCTGACATGCTGGCCACGGACCTCG
CC
TACTACCTGGTCCGCAAAGGGATGCCATTCCGCCAGGCCCACGAGGCCTCAGGGAAAGCTGTGTTCAT
G
GCAGAGACTAAAGGAGTGGCTCTCAACCTGCTGTCGCTACAGGAGCTGCAGACCATCAGTCCCCTGTTC
TCA
GGTGATGTGAGTCACGTGTGGGACTACAGTCACAGCGTGGAACAGTACAGTGCCTTGGGTGGCACAG
CG
AAATCCAGTGTCGAATGGCAGATCAGGCAGGTGCGGGCCCTACTGCAAGCCCAGGAGCCCTAG


Translation (464 aa):
MASESGKLWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAYSRGLEKAGLLTKAEMQQILQGLDKV
A
EEWAQGTFKLHPNDEDIHTANERRLK
ELIGEAAGKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLI
G
TMVDRAE
AERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLG
V
DRELLRA
ELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTG
S
SLMPQKKNPDSLELIRSKAGRVFGR
CAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMIAVLQVATGVI
S
TLQ
IHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLF
S
GDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQVRALLQAQEP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser