Conserved Protein Domain Family
apcF

?
CHL00089: apcF 
allophycocyanin beta 18 subunit
Statistics
?
PSSM-Id: 100206
View PSSM: CHL00089
Aligned: 6 rows
Threshold Bit Score: 251.639
Threshold Setting Gi: 11465540
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11467419   1 MKDAITSLIATYDVTGKYFDDNAVDTLNAYFSTASARIESVKIINANVSTIIKTAASALFDEQPELIAPGGNANTTRRYA 80
gi 90994407   1 MQDAITAILNRYDLTGRYLDKTAVGQLESFFSSGLDRIKIAEIINDQATNILKEAAAQLYEEQPELLRPGGNSYTTRRYA 80
gi 11465540   3 LQDSIVNIISTYDNAGKYLDSNAITNIKKYFDTADTRLGIVKIINANSSLIIQQASSQLFERNPELIRPSGNAYTTRRYA 82
gi 30468084   1 MQDQISKIIRRYDFAGQYLDTKAINKVASYFQNAMERLQVVQVLQQDAVDIIKEASNALFTSQPELLRPSGNAYTTRRYA 80
gi 51210015   1 MQDAITTILNRYDLTGKYLDNIAIEELNNYFISASNRIKVIEIINCQASKIIKEAAARLYEEQPELLRPGGNSYTTRRYA 80
gi 11465681   1 MQDAITAILNRYDLTGRYLDKAAVTQLESFFSSGLDRIKIAEIINNQATNILKEASAQLYEEQPELLRPGGNSYTTRRYA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11467419  81 ACLRDIDYYLRYATYAIISADVDVLDERVLDGLKETYNSLGVSIAPTVRAIELLKNTSKELIKAAGISAVDFIDEPFDYM 160
gi 90994407  81 ACLRDIEYYLRYASYALVSGSTNILDQRVLNGLKDTYNSLSVPVAPTVRSIQLLQEIIEEELDLQSIKRTDIIQEPFQHL 160
gi 11465540  83 ACLRDIDYYLRYASYSIVANDTSVLSSRVLAGLKDTYNSLGVPLASIVTLLELLKELIKEKTKNIN-DAHKYIDEPFLYM 161
gi 30468084  81 ACLRDLEYYLRYAIYAILAGDMSILNERVLTGLADTYNSLGVPIGPTIIGINQLKEAAKKRINS------PYIDEVFDHM 154
gi 51210015  81 ACLRDIEYYLRYVSYAIVAADTNILKERVLDGLRDVYNSLNVPIAPTIRSINLLQEVTEEEIKSQNIDVINWIVEPFQYI 160
gi 11465681  81 ACLRDIEYYLRYTSYALIAGNTNILDQRVLNGLKDTYNSLSVPLAPTVRSIQLLQEIIEEELELQSITRKDIVQEPFQHL 160

                ....*....
gi 11467419 161 GKVLADSSL 169
gi 90994407 161 INALSEQDL 169
gi 11465540 162 MKILCENDV 170
gi 30468084 155 IKNLC---- 159
gi 51210015 161 IKNLSEEDI 169
gi 11465681 161 INALSEQDL 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap