Conserved Protein Domain Family
cpcA

?
CHL00170: cpcA 
phycocyanin alpha subunit; Reviewed
Statistics
?
PSSM-Id: 100270
View PSSM: CHL00170
Aligned: 6 rows
Threshold Bit Score: 291.906
Threshold Setting Gi: 30468099
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11465844   1 MKTPITEAIASADSQGRFLSNGELQAVNGRYQRAAASLGAARSLTNNAQRLITGAAQSVYTKFPYVTQMPGPTYASSAIG 80
gi 11467423   1 MKTPITEAIATADNQGRFLSNSELHASFGRFQRAASALEAARSLTSNSQKLIDGAAAAVYQKFPYTTQTFGPQYASTAEG 80
gi 11465527   1 MKTPITEAIATADSQGRFLSNTELQSCAGRFQRAGASLDAARSLTANAQRLIDGAAQAVYSKFPYTTQMTGPCYASSAIG 80
gi 90994569   1 MKTPITEAIASADSQGRFLSNGELQAINGRYQRAAASLGAARSLTNNAQRLITGAAQSVYTKFPYVTQMPGPTYASSAIG 80
gi 51210030   1 MKTPITEAIASADSQGRFLSNGELQSINGRYQRASASLEAARSLTSNAQRLITGAAQSVYTKFPFTTQMPGPTYASSAIG 80
gi 30468099   1 MKTPITEAIAAADSQGRFLSNTELQACFGRFQRAAASLEAARALTSNAQRLIDGAANAVYSKFPYTTQMTGACYASSAVG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11465844  81 KAKCARDIGYYLRMVTYCLVVGATGPMDEYLVAGLEEINRSFELSPSWYVEALQYIKGSHGLSGQIGNEANVYLDYAINT 160
gi 11467423  81 KAKCTRDIGYYLRIVTYALVAGGTGPLDEYLVAGLEEMNRAFDLSPSWYVEALKYIKANHGLSGQAATEANGYFDYVINA 160
gi 11465527  81 KAKCSRDIGYYLRMVTYCLVAGGTGPMDEYLVAGLEEINRTFDLSPSWYVEALKNIKASHGLSGAAASEANAYINYAINS 160
gi 90994569  81 KAKCARDIGYYLRMVTYCLVVGATGPMDEYLVAGLEEINRSFELSPSWYVEALQYIKGSHGLSGQIGNEANVYLDYAINT 160
gi 51210030  81 KAKCARDIGYYLRMTTYCLVVGATGPMDEYLIAGLEEINRSFELSPSWYIEALQYIKNSHSLSGQAANEANTYLDYAINA 160
gi 30468099  81 KAKCSRDVGYYLRMITYCLVAGGTGPMDEYLVAGLDEVNRAFDLSPSWYIEALKYIKANHGLSGAAASEANAYINYAINA 160

                ..
gi 11465844 161 LS 162
gi 11467423 161 LS 162
gi 11465527 161 LS 162
gi 90994569 161 LS 162
gi 51210030 161 LS 162
gi 30468099 161 LS 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap