Conserved Protein Domain Family
cpcB

?
CHL00171: cpcB 
phycocyanin beta subunit; Reviewed
Statistics
?
PSSM-Id: 100271
View PSSM: CHL00171
Aligned: 6 rows
Threshold Bit Score: 293.058
Threshold Setting Gi: 11467422
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30468100   1 MLDAFSKVVAQADARGEFLSNTQFDALAKMVADGNKRLDAVAAITANASTIVTNAARSLFAEQPQLIQPGGNAYTNRRMA 80
gi 11465843   1 MLDAFAKVVAQADARGEFLSNTQLDALSSMVAEGNKRLDVVNKINSNASAIVTNSARALFAEQPQLIQPGGNAYTNRRMA 80
gi 90994568   1 MLDAFAKVVAQADARGEFLSNTQLDALSSMVAEGNKRLDVVNKINSNASAIVTNSARALFAEQPQLIQPGGNAYTSRRMA 80
gi 51210029   1 MLDAFAKVVAQADARGEFLSNTQLDALANMVAEGNKRLDIVNKINSNASAIITNSARSLFAEQPQLVQPGGNAYTNRRMA 80
gi 11465528   1 MLDAFSKVVAQADARGEFLSNTQLDALSKMVADGNKRLDATAAISANAATIVTNAARSLFSEQPQLIQPGGNAYTNRRMA 80
gi 11467422   1 MLDAFGKVVAQADARGEFISSAQFDALSKLASEGNKRLDAVQGITASAATIVSSAARSLFAEQPQLIAPGGNAYTNRRVA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30468100  81 ACLRDMEIILRYISYAMIAGDSSVLDDRCLNGLRETYQALGVPGASVALGVEKMKEAAISFVNDSSNVTVGDCSALVSEL 160
gi 11465843  81 ACLRDMEIVLRYVSYAMIAGDSSVLDDRCLNGLRETYQALGTPGSSVSVAVQKMKEASVALANDLTGTPQGDCSALVAEL 160
gi 90994568  81 ACLRDMEIVLRYVSYAMIAGDSSVLDDRCLNGLRETYQALGTPGSSVSVAVQKMKEASVALANDLTGITQGDCSALIAEL 160
gi 51210029  81 ACLRDMEIVLRYVSYAMIAGDSSVLDDRCLNGLRETYQALGTPGTSVAVAIQKMKEASVSLANDSNGTPIGDCSSLTAEL 160
gi 11465528  81 ACLRDMEIILRYVSYATIAGDSSVLDDRCLNGLRETYQALGVPGASVALAVEKMKEAAIAFANDSSNVTIGDCSALISEI 160
gi 11467422  81 ACLRDLEIVLRYITYATLAGDSSVLDDRCLNGLRETYQALGVPGSSVAVAIQKMKDAAVSVVNDPSGVTVGDCSALASEV 160
                       170
                ....*....|..
gi 30468100 161 ATYFDRAAKAVV 172
gi 11465843 161 GSYFDRAAVSVV 172
gi 90994568 161 GSYFDRAAVSVV 172
gi 51210029 161 GVYFDRAAVAVV 172
gi 11465528 161 ATYFDRAAKAVV 172
gi 11467422 161 ASYFDRAAAAVV 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap