Conserved Protein Domain Family
cpeB

?
CHL00172: cpeB 
phycoerythrin beta subunit; Provisional
Statistics
?
PSSM-Id: 133617
View PSSM: CHL00172
Aligned: 5 rows
Threshold Bit Score: 327.412
Threshold Setting Gi: 149072086
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11467645    1 MLDAFSRVVTNADAKAAYVGGADLQALKKFISEGNKRLDAVNSVVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMA 80
gi 90994558    1 MLDAFSRVVVNSDAKAAYVGGSDLQALKKFIAGGNKRLDSVNAIVSNASCIVSDAVSGMICEXPGLIAPGGNCYTNRRMA 80
gi 11465833    1 MLDAFSRVVVNSDAKAAYVGGSDLQALKKFIADGNKRLDSVNAIVSNASCIVSDAVSGMICENPGLIAPGGNCYTNRRMA 80
gi 51210019    1 MLDAFSRVVIDSDTKAAYVGGSNLQALKTFISEGNQRLDAVNSIVSNASCIVSDAVSGMICENPGLTSPGGNCYTNRRMA 80
gi 149072086   1 MLDAFSRVVTNADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSDAVSGMICENPSLISPSGNCYTNRRMA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11467645   81 ACLRDGEIILRYVSYALLSGDSSVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFINNTASQRKLSTPQGDCSG 160
gi 90994558   81 ACLRDGEIILRYVSYALLAGDPSVLEDRCLNGLKETYIALGVPTNSSVRAVSIMKAAAVAFITNTASQRKMATADGDCSA 160
gi 11465833   81 ACLRDGEIILRYVSYALLAGDPSVLEDRCLNGLKETYIALGVPTNSSVRAVSIMKASAVAFITNTASQRKMATADGDCSA 160
gi 51210019   81 ACLRDGEIILRYISYALLAGDPSVLEDRCLNGLKETYIALGVPITSSARAVNIMKASVAAFILNTAPGRKMDTASGDCTA 160
gi 149072086  81 ACLRDGEIILRYVSYALLSGDSSVLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTPQGDCSG 160
                        170
                 ....*....|....*..
gi 11467645  161 LASECASYFDKVTAAIS 177
gi 90994558  161 LASEVASYCDRVAAAIS 177
gi 11465833  161 LASEVASYCDRVAAAIS 177
gi 51210019  161 LASEVGSYFDRVCAAIS 177
gi 149072086 161 LASEVAGYFDKVTSAIS 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap