Conserved Protein Domain Family
cpeA

?
CHL00173: cpeA 
phycoerythrin alpha subunit; Provisional
Statistics
?
PSSM-Id: 100273
View PSSM: CHL00173
Aligned: 3 rows
Threshold Bit Score: 286.252
Threshold Setting Gi: 90994559
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51210020   1 MKSVITTVISAADAAGRFPSSSDLESIQGNIQRASARLEAAEKLADNHDAVVKEAGDACFGKYSYLKNAGEAGENQEKVN 80
gi 90994559   1 MKSVITTTISAADAAGRFPSSSDLESVQGNIQRAAARLEAAEKLASNHEAVVKEAGDACFAKYSYLKNPGEAGDSQEKVN 80
gi 11465834   1 MKSVITTTISAADAAGRFPSSSDLESVQGNIQRAAARLEAAEKLASNHEAVVKEAGDACFAKYSYLKNPGEAGDSQEKVN 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51210020  81 KCYRDIDHYMRLVNYSLVVGGTGPLDEWAIAGAREVYRTLNLPTSAYVAAFAFTRDRLCVPRDMSAQAGVEYTTALDYII 160
gi 90994559  81 KCYRDVDHYMRLVNYCLVVGGTGPVDEWGIAGAREVYRTLNLPTSAYVASFAFARDRLCVPRDMSAQAGVEYAGNLDYII 160
gi 11465834  81 KCYRDVDHYMRLVNYCLVVGGTGPVDEWGIAGAREVYRTLNLPTSAYVASFAFARDRLCVPRDMSAQAGVEYAGNLDYII 160

                ....
gi 51210020 161 NSLS 164
gi 90994559 161 NSLC 164
gi 11465834 161 NSLC 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap