Conserved Protein Domain Family
COX1

?
MTH00007: COX1 
cytochrome c oxidase subunit I; Validated
Statistics
?
PSSM-Id: 133649
View PSSM: MTH00007
Aligned: 7 rows
Threshold Bit Score: 870.761
Threshold Setting Gi: 238866905
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52696459    1 MRWLYSTNHKDIGTMYFMLGTWGGLLGTSMSLLIRVELGQPGPFLGSDQLYNTIVTAHAFLMIFFMVMPIFIGGFGNWLV 80
gi 150375679   1 MRWLYSTNHKDIGTLYFILGVWAGMVGAGMSLLIRIELSQPGAFLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLL 80
gi 5835192     1 MRWFYSTNHKDIGTLYFILGVWAGMVGAGMSLLIRIELSQPGAFLGSDQLYNTIVTAHXFVMIFFLVMPVFIGGFGNWLL 80
gi 54310655    1 MRWLYSTNHKDIGTLYFILGTWGGLLGTSMSLMIRAELGQPGSLLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLV 80
gi 192288378   1 MRWLYSTNHKDIGTLYFILGAWGGLLGTSMSLLIRIELGQPGAYLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLI 80
gi 192288406   1 MRWLFSTNHKDIGTLYFLFGVWGGLLGTSMSLLIRVELGQPGSFLGSDQLYNTIVTAHALLMIFFLVMPILIGGFGNWLI 80
gi 238866905   1 MRWLYSTNHKDIGTLYFILGTWGGLLGTSMSLMIRAELGQPGSLLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52696459   81 PLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASAAVEKGVGTGWTVYPPLSSNLAHAGPSVDLAIFSLHLAGVSSILGAIN 160
gi 150375679  81 PLMLGAPDMAFPRLNNMSFWLLPPSLILLVSSAAVEKGAGTGWTVYPPLASNIAHAGPSVDLAIFSLHLAGASSILGAIN 160
gi 5835192    81 PLMLGAPDMAFPRLNNMSFWLLPPSLILLVSSAAVEKGAGTGWTVYPPLASNLAHAGPSVDLAIFSLHLAGASSILGAIN 160
gi 54310655   81 PLMLGAPDMAFPRLNNMSFWLLPPALTLLVSSALIGGGVGTGWTVYPPLAGNMAHSGPSVDLAIFSLHLAGVSSILGALN 160
gi 192288378  81 PLMLGAPDMAFPRMNNMSFWLLPPALILLVSSAAVEKGVGTGWTVYPPLSDNMAHAGPSVDLAIFSLHLAGISSILGSIN 160
gi 192288406  81 PLMLGAPDMAFPRMNNMSFWLLPPALLLLLSSAAVEKGVGTGWTVYPPLASNLAHAGPSVDLAIFSLHLAGISSILGAIN 160
gi 238866905  81 PLMLGAPDMAFPRLNNMSFWLLPPALTLLVSSALIGGGVGTGWTVYPPLSGNMAHSGPSVDLAIFSLHLAGVSSILGALN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52696459  161 FITTAINMRSEGLQLERMPLFVWSVKITAILLLLSLPVLAGAITMLLTDRNLNTAFFDPAGGGDPILYQHLFWFFGHPEV 240
gi 150375679 161 FITTVINMRWSGLRLERIPLFVWAVVITVVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEV 240
gi 5835192   161 FITTVINMRWSGLRLERIPLFVWAVLITVVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEV 240
gi 54310655  161 FITTVINMRWDGLRPERMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNLNTAFFDPQGGGDPVLYQHLFWFFGHPEV 240
gi 192288378 161 FITTVINMRWKGLRLERVPLFVWAAVITTVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFFGHPEV 240
gi 192288406 161 FITTVANMRWKGLRLERIPLFVWAVNITVILLLLSLPVLAGAITMLLTDRNVNTSFFDPAGGGDPILYQHLFWFFGHPEV 240
gi 238866905 161 FITTVINMRWDGLRPERMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNLNTAFFDPQGGGDPVLYQHLFWFFGHPEV 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52696459  241 YILILPAFGAISHIVAHHSGKPEPFGTLGMIYAMSGIGVLGFIVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKVFSW 320
gi 150375679 241 YILILPGIRSYFHIVTHYTGKLEPFGALGMIYAMLGIAVLGFIVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKVFSW 320
gi 5835192   241 YILILPGFGAISHIVSHYTAKLEPFGALGMIYAMLGIAVLGFIVWAHHMFTVGLDVDTRAYFTAVTMIIAVPTGIKVFSW 320
gi 54310655  241 YILILPGFGAISHIVTQHASKMESFGTLGMIYAMLGIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
gi 192288378 241 YILILPGFGAISHIVTHYAGKLEPFGTLGMIYAMLGIGVLGFIVWAHHMYTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
gi 192288406 241 YILILPGFGAISHIVAHYAGKLEPFGTLGMIYAMLGIGVLGFIVWAHHMYTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
gi 238866905 241 YILILPGFGAISHIVTQHASKMKSFGTLGMIYAMLGIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52696459  321 LATISGSPIKTETPMLWALGFIFLFTVGGLTGIVLSNSSLDVILHDTYYVTAHFHYVLSMGAVFALFAGFNYWFPLFTGV 400
gi 150375679 321 LATLHGSKFKYETPMLWALGFIFLFTTGGITGIILSNSSLDIMLHDTYYVVAHFHYVLSMGAVFAIFAAFTHWFPLLSGL 400
gi 5835192   321 LATIHGSKIKYETPVLWALGFIFLFTTGGLTGIILSNSSLDIILHDTYYVVAHFHYVLSMGAVFAIFAAFTHWFPLLTGL 400
gi 54310655  321 LATLHGSPIKYDTPILWALGFIFLFTTGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAMFAAFNHWFPLFTGL 400
gi 192288378 321 LATIFGSRIKYETPMMWALGFIFLFTVGGLTGIMLSNASIDTILHDTYYVTAHFHYVLSMGAVFAMFAAFYHWFPLLSGF 400
gi 192288406 321 LATIFGSQIKYEPAMTWALGFIFLFTMGGLTGIVLSNASLDTMLHDTYYVTAHFHYVLSMGAVFAIFAAFNHWFPLFSGI 400
gi 238866905 321 LATLHGSPIKYDTPILWALGFIFLFTTGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAMFAAFNHWFPLFTGL 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52696459  401 TLHDRWTKIHFLAMFVGVNLTFFPQHFLGLAGMPRRYSDYPDTYLKWNIISSAGSMISFVALLFFIFILWEALSAQRGVI 480
gi 150375679 401 TLHTRWANAQFFLMFLGVNITFFPQHFLSLGGMPRRYSDYPDAFTKWNVVSSLGSLLSFVALMLFIFILWEAFASQRSVL 480
gi 5835192   401 TLHHRWANAQFFLMFLGVNTTFFPQHFLGLSGMPRRYSDYPDAFMKWNVVSSFGSLLSFVALMLFIFILWEAFASQRSVI 480
gi 54310655  401 TLHNRWSKVHFYMMFFGVNLTFFPQHFLGLAGMPRRYSDYPDAMTKWNVVSSIGSMVSFLALILFIFLLWEAFSAQRGVI 480
gi 192288378 401 TLHARWAKAPFIIMFLGVYITFFPQHFLGLSGMPRRYSDYPDAYTKWNIISSFGSMLSFIALLFFIFILWEAFSAQRTVI 480
gi 192288406 401 TLHARWAKIHFFLMFVGVNLTFFPQHFLGLSGMPRRYSDYPXAYTKWNMISSFGSMIPFIALLFFIFILWEAFSAQRPVI 480
gi 238866905 401 TLHDRWSKVHFYMMFFGVNLTFFPQHFLGLAGMPRRYSDYPDAMTKWNVVSSIGSMVSFLALILFIFLLWEAFSAQRGVI 480
                        490       500       510
                 ....*....|....*....|....*....|...
gi 52696459  481 AASHLGAALEWQDLapFPLDHHNMPETGLITTP 513
gi 150375679 481 ASPHLPTSMEWADTt-LPLDFHNLSETGIITYP 512
gi 5835192   481 SSPHMSSALEWSDPi-LPLDFHNLSETGIITYP 512
gi 54310655  481 ASPHMSSSLEWQYT--LPLDFHNADETGVITQ- 510
gi 192288378 481 GMSHMSSSLEWQDS--LPLDFHNIPETGITSTP 511
gi 192288406 481 ATSHLPSSMEWQEI--LPLDFHNLPETGVITSS 511
gi 238866905 481 TSPHMSSSLEWQYT--LPLDFHNADETGVITQ- 510
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap