Conserved Protein Domain Family
ND4L

?
MTH00013: ND4L 
NADH dehydrogenase subunit 4L; Validated
Statistics
?
PSSM-Id: 133655
View PSSM: MTH00013
Aligned: 6 rows
Threshold Bit Score: 88.2694
Threshold Setting Gi: 5835200
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 150375687  2 INTTQTILCLLPIMAMMNMLLNQTHFLMTLLSLEGITLSLVLFIPLILMNAQAPNAAMAVILLTFGACEASLGLSLMVTM 81
gi 5835200    2 YSSIMSLVFLLPIVAVVNLISNQSHFLMTLLSLEGITLSLVLFVPISLSIMSASNVSISVILLTFGACEASLGLSLMVLM 81
gi 54310658   1 MTSPLFLFSISGLICLFVLSLQRKHLLMSLLTLEAFILSMAILIPMSIMFQNQVNGMFAIVLLTMGACEASLGLSLLVLM 80
gi 192288414  1 -MILLMILSCSVFFSMLTFSIQRKHLLMSLLSLEAMILTLTMLTVCSLGLAPQFNTYLFIVLLTFGACEASLGLSLLVAM 79
gi 192288386  1 -MTSPFIMIISFFSSTASLLIQRKHLLMSLLSLEAMMLSMACFIMFSIGSTIQWNPFLFIVVLTFGACEASLGLSLLVII 79
gi 238866908  1 MTSPLFLFSISGFICLFVLSLQRKHLLMSLLTLEAFILSMAILIPLSIMFQNQVNGMFAIVLLTMGACEASLGLSLLVLM 80
                        90
                ....*....|....*..
gi 150375687 82 SRSYGNDMLKSLTSTKC 98
gi 5835200   82 SRSYGTDMLNSLTANKC 98
gi 54310658  81 TRSYGNDLLKSITKNLC 97
gi 192288414 80 TRYFGNDYTNLLTMNKC 96
gi 192288386 80 TRTSGSDMMKTLSSSKC 96
gi 238866908 81 TRSYGNDLLKSITKNLC 97
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap