Conserved Protein Domain Family
CYTB

?
MTH00033: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 133672
View PSSM: MTH00033
Aligned: 4 rows
Threshold Bit Score: 628.891
Threshold Setting Gi: 124359005
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124359022   1 MRLRKTGLLAPVNDIIDLPTPSNISYWWNFGSLLSLCLGIQILTGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80
gi 124358991   1 MRLRKTGLLEPVNGIIDLPTPSNISYWWNFGSLLCLCLGIQILTGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80
gi 124359005   1 MRLRKTGLLEPVNDIIDLPTPSNISYWWNFGSLLCLCLGIQIITGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80
gi 108860654   1 MRLRKTGLLAPVNDIIDLPTPSNISYWWNFGSLLGLCLGIQILTGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124359022  81 ANGASLFFICVYCHIGRGLYYGGYSRVLTWIVGVLIYFIMMLTAFIGYVLPWGQMSFWGATVITNLVSALPSVGGSIVEW 160
gi 124358991  81 ANGASLFFICVYCHIGRGLYYGGYSRVLTWIVGVLIFFIMMLTAFIGYVLPWGQMSFWAATVITNLVSALPSVGSSIVEW 160
gi 124359005  81 ANGASLFFICVYCHIGRGLYYGGYSRILTWIVGVFIFFIMMLTAFIGYVLPWGQMSFWAATVITNLVSAIPSVGGSIVEW 160
gi 108860654  81 ANGASLFFICVYCHIGRGLYYGSYSRVLTWIVGVLIYFIMMLTAFIGYVLPWGQMSFWGATVITNLVSAIPSVGGSIVEW 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124359022 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGSNNPLGVVSFSDRSPFHVYFTIKDILGFLILFGVFVIIG 240
gi 124358991 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGSNEPLGLVGLSDRTAFHVYFTIKDILGFLILFLILVIIG 240
gi 124359005 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGSNEPLGLVGLSDRTAFHVYFTIKDILGFLFLFFLFVIIG 240
gi 108860654 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGANNPLGVVSLSDRSTFHVYFTIKDILGFLILLGVFVIIG 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124359022 241 IEPRIEELLQDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLFLPILDRSAplgPRSLTFN 320
gi 124358991 241 IEPRIETLLQDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLLMPILDRSK---IRSLTFN 317
gi 124359005 241 IEPRIETLLQDPENYIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLLMPILDCSK---IRSLTFN 317
gi 108860654 241 IEPRIETLLQDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLLMPILDRSK---IRSLTFN 317
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 124359022 321 PVAKFFFWFIVGDFFILTWIGSAPAGTEPYVLIGRIATIFYFGYFLVLVPLLGYLSNLFYEYNGTT 386
gi 124358991 318 PTGKFFFWFIVGDFIILTWIGSAPAGADPYVLIGRIATIFYFGYFLVLVPLLGYLSNLFYEYNGTS 383
gi 124359005 318 PTGKFFFWFFVGDFIILTWIGSAPAGADPYVLIGRIATIFYFGYFLVLVPLLGYLSNSFYEHNAGR 383
gi 108860654 318 PVAKFFFWFIVGDFFILTWIGSAPAGTEPYVLIGRIATIFYFGYFLVLVPLLGYLSNLFYEYNGTT 383
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap