Conserved Protein Domain Family
SAA

?
pfam00277: SAA 
Serum amyloid A protein
Statistics
?
PSSM-Id: 395215
View PSSM: pfam00277
Aligned: 24 rows
Threshold Bit Score: 145.131
Threshold Setting Gi: 117607638
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBL43865     575 DYTVGAIGGAADFVDNYGDMRDANTIGGDKYFHCKANCEAAQRGQGGQDAARCISDSREWFDQHWpkNDPPSASAADQVA 654 gamma proteobac...
Q642J9        22 RFPGEAAGGAKDMWRAYQHMKEANWKNSDKYFHARGNYEAAQRGPGGYWAAKVISDGREALQGLI--RRGNSDAAADQEA 99  zebrafish
Q4SI54        22 KFPGQAVRGSHDMYRAYRDMRKANWKNSDKYFHARGNYDAAQRGPGGRWAAKVISDAREWAQQKT--GRGASDSAADQAA 99  spotted green p...
Q12LF8        56 lnqRQWIGGAYDFFGNYRDMRDANTIGADKYFHCKANCEATKRGKGGESAACTISDSREWFDQHIk-GDPA--SAADQAA 132 Shewanella deni...
EEN48139      44 DRTREAAQGAGDMYSAYRDMRESNWRNSDKYFHARGNYDAAQRGPGGRWAAEVISNAREGYQSGLs-GQGEVDTRADQEA 122 Florida lancelet
XP_006642759  22 MFPVEAARGAGDMWSAYDDMREANWKNSDKYFHARGNRDAASRGPGGKWAAEVISNAREWWQGSAs-GRGHEDTEADQEA 100 spotted gar
XP_016154381  32 QFVRDAAGGTRDMYRAYKDMREANYRGADKYFHARGNYDAARRGPGGAWAARVISDARENWQSRVs-GRGAEDTRADQEA 110 Collared flycat...
XP_011679821  37 DFVSGAVRGAGDMWRSYSDMREANTIGADKYFHARGNYEASQRGSGGRFAARVISDAREGWQGGVs-GRGAKDTQADQEA 115 purple sea urchin
XP_003969731  26 RFMKQFAQGSADMLRAYRDMREANWKNSDKYFHARGNYDAASRGAGGRVAAAVISNTWEGIQRAR--GRHAEDSEADQIA 103 torafugu
XP_016278912 110 RFVKEAGQGAGDMWRAYRDMREANYKNSDKYFHARGNYDAARRGPGGAWAARVISDGREFFQGGSs-GRGVEDSRADQFA 188 gray short-tail...
CBL43865     655 NLYGRTQGAENTggncqqicapFRPNGLPSQY 686 gamma proteobacterium HdN1
Q642J9       100 NLWGRNGGDPNK----------YRPKGLPIKY 121 zebrafish
Q4SI54       100 NRWGRNGGNPNV----------YRPRGLPRRY 121 spotted green pufferfish
Q12LF8       133 NIFGRSNASSPQscsl--vcsaFRPNGLPQGY 162 Shewanella denitrificans OS217
EEN48139     123 NNWGRNGGDPNR----------YRPEGLPDRY 144 Florida lancelet
XP_006642759 101 NRWGRDGGDLSK----------YRPKDLPEKY 122 spotted gar
XP_016154381 111 NRWGRSGGDPNR----------YRPRGLPSKY 132 Collared flycatcher
XP_011679821 116 NRWGRNGGDPNR----------YRPAGLPDGY 137 purple sea urchin
XP_003969731 104 NRWGRNGGDPNR----------FRPKGLPSKY 125 torafugu
XP_016278912 189 NRWGRSGKDPNF----------FRPPGLPSKY 210 gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap