Conserved Protein Domain Family
Defensin_propep

?
pfam00879: Defensin_propep 
Defensin propeptide
Statistics
?
PSSM-Id: 395707
View PSSM: pfam00879
Aligned: 33 rows
Threshold Bit Score: 38.3552
Threshold Setting Gi: 118415
Created: 22-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELV14234      1 MRTLTLISAILLVTLQAQADPLPDTSDEVQVQEQAAAENPDVAISFAGDE 50  Chinese tree shrew
P07469        1 MRTLILLAAILLAALQAQAELFSVNVDEVLDQQQPGS-DQDLVIHLTGEE 49  rabbit
NP_001075768  1 MRTLALLAAILLVTLQAQAELHSGMADDGVDQQQPRAQDLDVAVYIKQDE 50  rabbit
P01377        1 MRTLALLAAILLVALQAQAEHISVSIDEVVDQQPPQAEDQDVAIYVKEHE 50  rabbit
EHB12813      1 MRTLALLAAILLLALQAQAERLPGRADQAEPEVQAEEEEQVTVISFPGEE 50  naked mole-rat
P49112        1 MRTVPLFAACLLLTLMAQAEPLPRAADHSDTKMKGDREDHVAVISFWEEE 50  domestic guinea pig
2_pfamImport  1 MKTLALLAAILLLALQAQAEPLRQTADKVQAQDKPGAEDLDVVVSFTGEE 50 
Q62714        1 MRTLTLLITLLLLALHTQAESPQERAKAAPDQDMV-MEDQDIFISFGGYK 49  Norway rat
XP_007624049  1 MRTLALLIALLLLAFETQAETFQGTDEGVLDQEQLGADNQDMSISFGGDE 50  Chinese hamster
EGW04728      3 MRTLTLLVALLLLAFETRAEPFEGSAEELLDQDLLGEDDQDMSISFGGDE 52  Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap