Conserved Protein Domain Family
Arteri_Gl

?
pfam00951: Arteri_Gl 
Arterivirus GL envelope glycoprotein
Arteriviruses encode 4 envelope proteins, Gl, Gs, M and N. Gl envelope protein, is encoded in ORF5, and is 30- 45 kDa in size. Gl is heterogenously glycosylated with N-acetyllactosamine in a cell-type-specific manner. The Gl glycoprotein expresses the neutralisation determinants.
Statistics
?
PSSM-Id: 109986
View PSSM: pfam00951
Aligned: 11 rows
Threshold Bit Score: 116.402
Threshold Setting Gi: 138776
Created: 13-Jul-2016
Updated: 7-Dec-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123882314  25 LA-VLVNaSNNNSSHIQ-LIYNLTLCELNGTNWLAQKFDWAVETFVIFPVLTHIVSYGALTTSHFLDTVGLATV-STAGY 101
gi 81953423   28 SW-SFVD-GNDSSSTYQ-YIYNLTICQLNGTESLSTHFDWAVDTFVLYPGCHSIFFHWVISQQANFLMRSASALcPLQDL 104
gi 81953422   28 SW-SFAD-GNGNSSTYQ-YIYKLTICELNGTEWLSTHFDWAVETFVLYPVATHILSLGFLTKSHFFDALGLGAV-STTGF 103
gi 138776      1 MG-AIDS--------------------FCGDGILGEYLDYFILSVPLLLLLTRYVASGLVYVLTALFYSFVLA--AYIWF 57
gi 308191599   1 MG-GLEF--------------------CDQTSWYQIFIAFSLTYTPIAIYSLKVFRGTLAGIVNIFIFINCCVSfVYLMY 59
gi 81922056    1 MG-GLDD------------------FCFDHTAAQKLVLAFSITYTPIMIYALKVSRGRLLGLLHILIFLNCSFTfGYMPY 61
gi 81925655   41 LS-TENAcVAGDSSTKN-LIYTSTLCELNVTG-FQQHFGYAVETFVIFPAVTHLISLKFLTTAHLLDFLSLGVV-AGGGY 116
gi 85720350   28 SW-SFVD-GNDSSSTYQ-YIYNLTICELNGTESLSSHFDWAVETFVLYPVATHILSLGFLTTSHFFDALGLGAV-STTGF 103
gi 118776574  81 NN-TYAVpVSTVLEQAH-GPYSTLFDDMPPFIYYGREFGIFVMDVFMFYPVLVLFFLSVLPYATLILERCVSILfVVYGL 158
gi 116664768   1 MGsSLDD------------------FCNDSTAPQKVLLAFSITYTPVMIYALKVSRGRLLGLLHLLIFLNCAFTfGYMTF 62
gi 675118316 111 QS-LLSNcSTCFTHLSScFLHTYTGHHINNTRLL-------LETYLAVPLLTHLLSYKFATTASFLDFAFFAGL-SITAY 181
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123882314 102 YHGRYVLSSIYAVCALAALIC----FVIR----LA--KNCMSWRYSCTRYTNFLLDTKGR--LYRWRSPv-IVEKGGKVE 168
gi 81953423  105 LARRYVLKKMYGACAFPALVF----FVIR----AD--KNCMACPYARTRFTNFPVDDRGR--NHRWKSP--MVEKLGKAE 170
gi 81953422  104 VGGRYVLTSVYGACALPALVF----FVIR----AA--KIAWLGATPAPGSPTLLWTTGGT--IHRKVSPi-VVEKLGKSE 170
gi 138776     58 VIVGRAFSTAYAFVLLAAFLLlvmrMIVGm---MPrlRSIFNHRQLVVA--DFVDTPSGPvpIPRSTTQv-VVRGNGYTA 131
gi 308191599  60 -HHSVTNTIALSLGAVIALVWgiytLVKIvdwlVIrcRLCFLGRSYILAPPSHVDTSDGRqsLTTSLTTafVVRKPGSTL 138
gi 81922056   62 VHFESTNRVALTLWAVVALLWgiysFTESwkfiTSrcRLCCLGRRYILAPTHHVESAAGLhsIPASGNRayAVRKPGLTP 141
gi 81925655  117 WHQQYVVSSIYASCALLAFIF----FCCR----AV--RNCMSWRYKCTRFTNFVLDTKGR--VFRNRSSv-LVEQHGKVL 183
gi 85720350  104 VGGRYVLSSVYGACAFAALVC----FVIR----AA--KNCMACRYARTRFTNFIVDDRGR--IHRWKSPi-VVEKLGKAE 170
gi 118776574 159 ------YSGAYLAMGIFATTLvvhsLVVL----RQllWLCLAWRYRCTLHASFI-SAEGK--IYPVDPGlpIAAAGNRML 225
gi 116664768  63 VHFESTNRVALTMGAVVALLWgvysAIETwkfiTSrcRLCLLGRKYILAPAHHVESAAGFhpIAANDNHafVVRRPGSTT 142
gi 675118316 182 ---RYVSPAILFFLPL-ALIFsa-iFIKK----LV--VNCMALRFAWTRHTNFIIDDRGR--LFVNHDDv-LISDPQGLR 247
                        170       180       190
                 ....*....|....*....|....*....|.
gi 123882314 169 VEGHLI-DLKRVVLDGSAATPLTRVSAEQWG 198
gi 81953423  171 VGGDLV-AIKHVVLEGVKAQPLTRTSAEQWK 200
gi 81953422  171 IDGDLV-TIKHMVLEGVKAQPLTRTSAKQWE 200
gi 138776    132 VGNKLVdGVKTITSAGRLFSKRTAATAYKLQ 162
gi 308191599 139 VNGQLVpDFQRLVLGGKKAVSKGAVNLLKYV 169
gi 81922056  142 VNGTLVpGLRSLVLGGKRAVKRGVVNLVKYG 172
gi 81925655  184 LQGQPI-EVKTVVLDGVKAVRAKTVPAEKWE 213
gi 85720350  171 VGGDLV-AIKHVVLEGVKAQPLTRTSAEQWE 200
gi 118776574 226 VPGRPT--IDYAVAYGSKVNLVRLGAAEVWE 254
gi 116664768 143 VNGTLVpGLKSLVLGGRKAVKQGVVNLVKYA 173
gi 675118316 248 VGPHKV-RAAKVILGGREANLLRQAHVEEWS 277
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap