Conserved Protein Domain Family
LacY_symp

?
pfam01306: LacY_symp 
Click on image for an interactive view with Cn3D
LacY proton/sugar symporter
This family is closely related to the sugar transporter family.
Statistics
?
PSSM-Id: 110319
View PSSM: pfam01306
Aligned: 5 rows
Threshold Bit Score: 554.375
Threshold Setting Gi: 447119765
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2V8N_A         1 MYYLKNTNFWMFGLFFFFYFFI-MGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWI 79
gi 125942      6 LAPRERHNFIYFMLFFFFYYFI-MSAYFPFFPVWLAEVNHLTKTETGIVFSCISLFAIIFQPVFGLISDKLGLRKHLLWT 84
gi 131823      4 ASTHKNTDFWIFGLFFFLYFFI-MATCFPFLPVWLSDVVGLSKTDTGIVFSCLSLFAISFQPLLGVISDRLGLKKNLIWS 82
gi 447119765   4 NIPFRN-AYYRFASSYSFLFFIsWSLWWSLYAIWLKGHLGLTGTELGTLYSVNQFTSILFMMFYGIVQDKLGLKKPLIWC 82
gi 1346408     1 MYYLKNTNFWMFGFFFFFYFFI-MGAYFPFFPIWLHEVNHISKGDTGIIFACISLFSLLFQPIFGLLSDKLGLRKHLLWV 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2V8N_A        80 ITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVG 159
gi 125942     85 ITILLILFAPFFIFVFSPLLQMNIMAGALVGGVYLGIVFSSRSGAVEAYIERVSRANRFEYGKVRVSGCVGWALCASITG 164
gi 131823     83 ISLLLVFFAPFFLYVFAPLLHLNIWAGALTGGVFIGFVFSAGAGAIEAYIERVSRSSGFEYGKARMFGCLGWALCATMAG 162
gi 447119765  83 MSFILVLTGPFMIYVYEPLLQSNFSVGLILGALFFGLGYLAGCGLLDSFTEKMARNFHFEYGTARAWGSFGYAIGAFFAG 162
gi 1346408    80 ITGMLVMFAPFFIYVFGPLLQVNILLGSIVGGIYLGFIYNAGAPAIEAYIEKASRRSNFEFGRARMFGCVGWALCASIAG 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2V8N_A       160 IMFTINNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVF 239
gi 125942    165 ILFSIDPNITFWIASGFALILGVLLWVSKPESSNSAEVIDALGANRQAFSMRTAAELFRMPRFWGFIIYVVGVASVYDVF 244
gi 131823    163 ILFNVDPSLVFWMGSGGALLLLLLLYLARPSTSQTAMVMNALGANSSLISTRMVFSLFRMRQMWMFVLYTIGVACVYDVF 242
gi 447119765 163 IFFSISPHINFWLVSLFGAVFMMINMRFK-DKDHQCIAADAGGVKKEDF-----IAVFKDRNFWVFVIFIVGTWSFYNIF 236
gi 1346408   160 IMFTINNQFVFWLGSGCAVILALLLLFSKTDVPSSAKVADAVGANNSAFSLKLALELFKQPKLWLISLYVVGVSCTYDVF 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2V8N_A       240 DQQ-FANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLIINRIGGKNALLLAGTIMSVRIIGsSFATSALEVVIL 318
gi 125942    245 DQQ-FANFFKGFFSSPQRGTEVFGFVTTGGELLNALIMFCAPAIINRIGAKNALLIAGLIMSVRILGsSFATSAVEVIIL 323
gi 131823    243 DQQ-FAIFFRSFFDTPQAGIKAFGFATTAGEICNAIIMFCTPWIINRIGAKNTLLVAGGIMTIRITGsAFATTMTEVVIL 321
gi 447119765 237 DQQlFPVFYAGLFESHDVGTRLYGYLNSFQVVLEALCMAIIPFFVNRVGPKNALLIGVVIMALRILScALFVNPWIISLV 316
gi 1346408   240 DQQ-FANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLIVNRIGGKNALLLAGTIMSVRIIG-SHSHTALEVVIL 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2V8N_A       319 KTLHMFEVPFLLVGCFKYITSQFEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVF 398
gi 125942    324 KMLHMFEIPFLLVGTFKYISSAFKGKLSATLFLIGFNLSKQLSSVVLSAWVGRMYDTVGFHQAYLILGCITLSFTVISLF 403
gi 131823    322 KMLHALEVPFLLVGAFKYITGVFDTRLSATVYLIGFQFSKQLAAILLSTFAGHLYDRMGFQNTYFVLGMIVLTVTVISAF 401
gi 447119765 317 KLLHAIEVPLCVISVFKYSVANFDKRLSSTIFLIGFQIASSLGIVLLSTPTGILFDHAGYQTVFFAISGIVCLMLLFGIF 396
gi 1346408   318 KTLHMFEIPFLIVGCFKYITSQFEVRFSATIYLVCFCFFKQLAMIFMSVLAGKMYESIGFQGAYLVLGIIRVSFTLISVF 397
                        410
                 ....*....|....*
2V8N_A       399 TLSGPGplSLLRRQV 413
gi 125942    404 TLKGSK--TLLPATA 416
gi 131823    402 TLSSSPg-IVHPSVE 415
gi 447119765 397 FLSKKReqIVMETPV 411
gi 1346408   398 TLSGPGpfSLLRRRE 412
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap