Conserved Protein Domain Family
HCV_env

?
pfam01539: HCV_env 
Hepatitis C virus envelope glycoprotein E1
Statistics
?
PSSM-Id: 110536
View PSSM: pfam01539
Aligned: 4 rows
Threshold Bit Score: 363.43
Threshold Setting Gi: 130468
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130461  193 QVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLC 272
gi 130469  193 EVRNVSGIYHVTNDCSNSSIVYEAADMIMHTPGCVPCVRESNFSRCWVALTPTLAARNSSIPTTTIRRHVDLLVGAAALC 272
gi 130466  193 EVKNISTGYMVTNDCTNDSITWQLQAAVLHVPGCVPCEKVGNTSRCWIPVSPNVAVQQPGALTQGLRTHIDMVVMSATLC 272
gi 130468  193 EVRNISSSYYATNDCSNNSITWQLTDAVLHLPGCVPCENDNGTLHCWIQVTPNVAVKHRGALTRSLRTHVDMIVMAATAC 272
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130461  273 SALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAH 352
gi 130469  273 SAMYVGDLCGSVFLVSQLFTFSPRRYETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVAGAH 352
gi 130466  273 SALYVGDLCGGVMLAAQMFIVSPQHHWFVQDCNCSIYPGTITGHRMAWDMMMNWSPTATMILAYAMRVPEVIIDIIGGAH 352
gi 130468  273 SALYVGDVCGAVMILSQAFMVSPQRHNFTQECNCSIYQGHITGHRMAWDMMLSWSPTLTMILAYAARVPELVLEIIFGGH 352
                      170       180       190
               ....*....|....*....|....*....|
gi 130461  353 WGVLAGIKYFSMVGNWAKVLVVLLLFAGVD 382
gi 130469  353 WGVLAGLAYYSMVGNWAKVLIVMLLFAGVD 382
gi 130466  353 WGVMFGLAYFSMQGAWAKVVVILLLAAGVD 382
gi 130468  353 WGVVFGLAYFSMQGAWAKVIAILLLVAGVD 382
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap