Conserved Protein Domain Family
Myosin_tail_1

?
pfam01576: Myosin_tail_1 
Myosin tail
The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.
Statistics
?
PSSM-Id: 396244
View PSSM: pfam01576
Aligned: 13 rows
Threshold Bit Score: 1282.81
Threshold Setting Gi: 528503547
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6URW6        869 TRQDEVLQARAQELQKVQELQQQSAREVGELQGRVAQLEEERTRLAEQLRAEAELCSEAEETRARLAARKQELELVVTEL 948  house mouse
XP_016851550  874 TRQDEVMQAKAVELQKVQEKHTKTQMDLKELENKYQQLSEEKTILAEQLQAETELFAEAEEMRARLAARKQELEDILHEL 953  green anole
XP_005157988  908 TRQDEEIQAREAQLQKAKDKLSKLELDFTELDKKNQQLIEEKSVLTDQLQAEAELFAEAEEMRARLANRKQELEDVLGEL 987  zebrafish
XP_018669542  853 TRQEEDLNAKERELKLVQEKKDELESSLHDIEKKFAQVCEEKNMLAEQLQTEQEVWNESEEMRARLAARKTELEEILQDM 932  vase tunicate
XP_025861267  908 TRQEEELQAKDEELLKVKERQTKVEGELEEMERKHQQLLEEKNILTEQLQAETELFAEAEEMRARLAAKKQELEEILHDL 987  red fox
XP_024840731  855 TRQEEEMQAKEDELQKTKERQQKAESELKELEQKHSQLTEEKNLLQEQLQAETELYAEAEEMRVRLAAKKQELEEILHEM 934  cattle
AAI62152      846 TRQEEEMSLKEEELQKAKESAQKFEIELKDIALKHTQLMDERNQLQEKLQAETELYAEAEEMRVRLASKKQELEEILHEM 925  zebrafish
CAG06107      924 TRQEEEMLAKEDELSKVKERQEQAEKMLKEYESKQQQLAAEKMALQEQLQAETELCAEAEELRARLVNRKQELEEILHDM 1003 spotted green...
XP_023268550  845 TRQEEEMLAKDEELVKVKERQLQAEEQLKEYESKQQQLNAEKSALQEQLQAETELCAEAEEMRARLATRKQELEEILHDL 924  Seriola lalan...
TNN57866      836 SRQEEEMQAKDDELVKVKEKHLYAEQQLQEMDEKQHQLSAEKMALQEQLQAETELCAEAEEMRARLAARKQELEEILHDL 915  Tanaka's snai...
TDH03366      925 TRQEEEMGQKDEELKAAKEVAAKVETELKDITQKHTQLMEERAQLEMKLHAETELYAEAEEMRVRLEAKKQELEEVLHEM 1004 yellow perch
XP_028459901  869 TRQEEELQAKDEELVKVKERQLKVENELVEMERKHQQLIEEKNILAEQLHAETELFAEAEEMRVRLLSRKQELEEILHDL 948  yellow perch
XP_004916275  855 TRQDEVMQAKVVELQKVKDTQVKTESELKEMANKYQQLFEEKSILAEQLQAETELFAEAEEMRARLASKKQELEEILHDL 934  tropical claw...
Q6URW6        949 EARVGEEEECSRQLQSEKKRLQQHIQELESHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERRLLEER 1028 house mouse
XP_016851550  954 ESRVEEEEERCQQLQGDKKKMQQHVQDLEEQLEEEEAARQKLQLEKVSTEAKLKKMEEDLLVLEDQNSKLHKERKLMEER 1033 green anole
XP_005157988  988 ESRLEEEEERTVQLTNEKKRIQQHVQDLEEQLEEEEGTRQRLQLEKVTLESKVKSLEAETLTLAEQRDRLSKEKKQLEER 1067 zebrafish
XP_018669542  933 EARLDEEEDRNQGMMQEKKKMQTNIKDLEEQLDEEEAARQKLQLEKVTLDAKCKKMDEDLNLLEDAQSKLQRERKALEER 1012 vase tunicate
XP_025861267  988 ESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDR 1067 red fox
XP_024840731  935 EARLEEEEDRSQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNNKLSKERKLLEER 1014 cattle
AAI62152      926 EARLEEEEDRGAALQMEKKKMHEQIKDLEEHLEEEEDARQKLQLEKVTCDAKIKKLEDDILIMDDQNNKLQKERKILEER 1005 zebrafish
CAG06107     1004 ESRLEEEEERANQLHIERKKMQQNIADLEQQLDEEEAARQKLQIEKVTTDSKIKEHEERILMLEDQNNKLNKTAS----- 1078 spotted green...
XP_023268550  925 ESRLEEEEERVTQMHTERKKMQQNITDLEQQLDEEEAARQKLHMEKVTTDAKLKKLEEDVMVLDDQNGKLNKEKKLLEER 1004 Seriola lalan...
TNN57866      916 EARVEEEEERASHLLSDKKKMQQNIGDLEQQLDEEEAARQKLQLEKVTLESKMKKIEDDVM-----------EKKLLEER 984  Tanaka's snai...
TDH03366     1005 ESRLEEEEDRSNALHNERKEMEQQLQLMEAHIAEEEDARQKLQMEKVSVEGKVKKLEEDILMMEDQNNKLQKERKLLEER 1084 yellow perch
XP_028459901  949 ESRVEEEEERNQSLQNEKKKMQSHIQDLEEQLDEEEAARQKLQLDKVTAEAKIKKMEEDILLLEDQNSKFLKEKKLLEDR 1028 yellow perch
XP_004916275  935 EARVEEEEERTLQLQNEKKKMHQHIQDLEEQLEEEEGARQKLQLEKVTTESRLKKMEEDILLLEDQNAKLAKERKLLDDR 1014 tropical claw...
Q6URW6       1029 LAEFSSQAAEEEEKVKSLNKLRLKYEATISDMEDRLKKEEKGRQELEKLKRRLDGESSELQEQMVEQKQRAEELLAQLGR 1108 house mouse
XP_016851550 1034 LSEFTSHMAEEEEKVKSLSKLRNKYEAVMADMEDRLKKEEKGRQELEKLKRKLDGEAGDLQEQVAELQQQLEELRQALAR 1113 green anole
XP_005157988 1068 LNEVTDQLTEEEEKVKSLNKLKNKQEAVIADIEERLKREEQGRLEQEKWKRRMEGEAVEAQEQLSDMSLLVTELRGSLSQ 1147 zebrafish
XP_018669542 1013 VNELEGTLGDEEEKAKMLSKLKHKNESVISDLQERLKKEEKLRQELEKIKRQLEAEIAELREQIADLQLQLEELRVQNQR 1092 vase tunicate
XP_025861267 1068 IAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKVQLAK 1147 red fox
XP_024840731 1015 ISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIAELQAQIAELKMQLAK 1094 cattle
AAI62152     1006 IADFSSNLAEEEEKSKNLTKLKNKHESMISELEVRLKKEEKTRQELDKAKRKLEAESNDLQEQIADLQAQIADLKAQLAK 1085 zebrafish
CAG06107     1079 ---------------------------------GKRRKCAKSWRRTVANWRASPRTSTT-RSQTCRPRSQIC-AA-QLAK 1122 spotted green...
XP_023268550 1005 ISECTTNLAEEEEKSKSLQKLKNKHEAMITDLEDRLRKEEKVRQELEKNRRKLEGDSTELNDQIADLQAQIAELRAQLAK 1084 Seriola lalan...
TNN57866      985 ISEYTTNLTEEEEKSKSLQKLKTKHEAMITDLEDRLRREEKQRQELEKNRRKLDGDFNEIHDQIAELQAQIAELRAQLAK 1064 Tanaka's snai...
TDH03366     1085 LADMSSNLAEEEEKSKNLSKLKTKHESMISELELRMKKEEKGRLDMEKAKRKVEAELGDLQEQHADLQAQLAELRAQLAA 1164 yellow perch
XP_028459901 1029 ISEMTSQLTEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELEKAKRKLDAETTDLQDQIVELQAQIEELKFQLTK 1108 yellow perch
XP_004916275 1015 IGEFTSTMAEEEEKVKSLNKLRNKYEAVIADLEDRLKKEEKGRQEMEKMKRKLDGETTDLQDQLLELQQQIEELKQQLAR 1094 tropical claw...
Q6URW6       1109 KEDELQAALLRAEEEGGARAQLLKSLREAQAGLAEAQEDLEAERVARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQE 1188 house mouse
XP_016851550 1114 KEAELQAALARVEDEAAQKNAVLKSLRELQAQLAELQEDMESEKLARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1193 green anole
XP_005157988 1148 REKEITTLQTRLEEEGARRTEAQRALREAMSQVSELKEEVENERGMRERAEKQRRDLGEELEALRTELEDTLDTTAAQQE 1227 zebrafish
XP_018669542 1093 KDDELAALQDKFDQEQTARSQLAKNHRELQNQNAEVLEDLEQERSQRNKAEKQKRDLSEELEALKTELEDSLDTTNAQQE 1172 vase tunicate
XP_025861267 1148 KEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQE 1227 red fox
XP_024840731 1095 KEEELQAALGRLDDEMAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQE 1174 cattle
AAI62152     1086 KEEELQAALARLEDETGQKNNALKKIRELEGHISDLQEDLESERAARNKAEKTKRDLGEELEALKSELEDTLDTTATQQE 1165 zebrafish
CAG06107     1123 KEEELQDALNRLDKSSADNTAAQKKNRELEAHILELEEDLARECGYRAQSTQRCKDLEEELEALKTELLDTLDSTAVQQE 1202 spotted green...
XP_023268550 1085 KEEELLAALARIEEEAAAKNTAQKKIRELEAQISELQEDLDLERQARSKAEKHRRDLGEELEALKTELEDTLDSTAAQQE 1164 Seriola lalan...
TNN57866     1065 KEEELQAALARIEEEAAQKNLAQKKIREMEAQLSELQEDLELERQARTKAEKHRRDLGEELEALKTELEDTQDSTAAQQE 1144 Tanaka's snai...
TDH03366     1165 KEEELQATQARLEEECNQRGAAVKRVRELEVLISELQEDLEAERAARGKVEAARRDLGEELNALRTELEDSLGTTAAQQE 1244 yellow perch
XP_028459901 1109 KEEELQAALARSDEETLQKNNALKQVRELQAHLAELQEDLESEKMCRSKAEKLKRDLSEELEALKTELEDTLDTTAAQQE 1188 yellow perch
XP_004916275 1095 KEEELQAALARVDDEVGQKNNLLKQLRDLQSQLAELHEDLESEKAARAKAEKQRRDLGEELEALKTELEDTLDSTAAQQE 1174 tropical claw...
Q6URW6       1189 LRSKREQEVTELKKALEEESRAHEVSMQELRQRHSQALVEMAEQLEQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSR 1268 house mouse
XP_016851550 1194 LRSKREQEVTELKKTIEEEVKVHEAQVLDMRQRHTSALEELSEQLEQSRRFKINLEKTKQALEGENAEMQKEVKLLQAAK 1273 green anole
XP_005157988 1228 LRSRREAELGELQRCLEEETRRHEAQLSELRIKHTAAIDSLQEQLDNAKRSRQSLEKAKAVLEEERLNLSAELKTLQGGK 1307 zebrafish
XP_018669542 1173 LKSQRERELENLKRTLESETTSFDTQLQQMRQKHNSQVETFQDELDVLKRNKSALEKSKHSLESENQELQEELRLVSGAK 1252 vase tunicate
XP_025861267 1228 LRTKREQEVAELKKALEEETRSHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVK 1307 red fox
XP_024840731 1175 LRAKREQEVTMLKKALDEETRSHESQVQEMRQKHTQVVEELTEQLEQFKRAKANLDKNKQALEKENAELAGELRVLSQAK 1254 cattle
AAI62152     1166 LRAKREQEVTLLKRAIEDESRVHEAQVQEMRQKHTQALEELTEQLEQSKRVKVNLEKAKQALEKETSELHVELRSLTQGK 1245 zebrafish
CAG06107     1203 LRTKRETEVAQLKKAGEEEKKMHEAQLAELSKKHFQTLNELNEQLEQTKRNKMSVEKAKQALESEFNELQTEMRTVNQRK 1282 spotted green...
XP_023268550 1165 LRSKRETEVTHLKKTLEEEAKSHEQQMADMRQKHNQAFEELNEQLEQAKRNKVSVEKSKQALESEWNELQIELKTLTQGK 1244 Seriola lalan...
TNN57866     1145 LRSKRETEVTHLKKTLDDEAKVHDQQLGEMRQKHGQAFDELNEQLEQAKRNKVSMEKAKQALESERNELVIEMQTLMQGK 1224 Tanaka's snai...
TDH03366     1245 LRAKREQEVSMLKKAMEDEGRSHEAQVQDLRQKHSQAVEELTEQLEQAKRVRAGLEKAKQALEKESADLSADLRSLASAK 1324 yellow perch
XP_028459901 1189 LRSKREQEVAELKKAIDEETKNHEAQIQEMRQRQATALEELSEQLEQAKRFKSNLEKNKQSLENDNKELSCDVKTLQQAK 1268 yellow perch
XP_004916275 1175 LRAKREQEVTDLKKTIEEDVKVRDAQVTEMRQRHNQVVEEISEQLEQARRFKGNLEKVKQTLESENTDLIKEVKNLQAAK 1254 tropical claw...
Q6URW6       1269 QEGEQKRRRLESQLQEVQGRSSDSERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGKELSSAESQLHDTQELLQEE 1348 house mouse
XP_016851550 1274 LESEQRRKKLEGQVQELQLRAGEGERAKAELVERLVKLQNELDGVSGTLGSTESKTIKLAKDLATVESHLQDTQELLQEE 1353 green anole
XP_005157988 1308 MESERGRKRAEGQLQELNARLSQAEREREEREERLGKLQSELESLSSSLSSSDSKSHRLHKEVSSLESQLHDVQELLQEE 1387 zebrafish
XP_018669542 1253 TDSETKRRKQDQQLQELSAKLQDTERQRNDLQDKLSKGQLEIESLSHNLEQVETQLSRSQKEASQLDSQLQDAQSQGQEE 1332 vase tunicate
XP_025861267 1308 AESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSSLLEEAEKKGIKFAKDAASLESQLQDTQELLQEE 1387 red fox
XP_024840731 1255 QEVEHKKKKLEVQLQELQSKYSDGEKVRAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEE 1334 cattle
AAI62152     1246 QDVEHKKKKLEGQLADLQSRFNDSERHKAELGDRVSKITVELESVTNLLNEAEGKNIKLSKDVASLSSQVQDTQELLAEE 1325 zebrafish
CAG06107     1283 SDTEHRRKKAESQVQELQVRCDETERQKQEALEKVAKLQSELDNVNAIVNALEGKCTKSSKDLSSVESHLQDTQELLQEE 1362 spotted green...
XP_023268550 1245 GDSEHRRKKAEAQVQELQVKHGESERQRQELADKMTKMQSELDNVNSLLSEAEGKCIKSSKDLSSVESQLQDTQELLQEE 1324 Seriola lalan...
TNN57866     1225 GDSEHRRKKAEAQVQELLLKHSESERQRLEQAEKLAKVQTELESVTTVLSDLEGKSIKATKDCSAVESQLQDVQELLQEE 1304 Tanaka's snai...
TDH03366     1325 QDVEHKKKKVEGQLNELNSRFNESERQRTELGERVSKLTTELDSVTGLLNEAEGKNIKLSKDVSSLSSQLQDAQELLSEE 1404 yellow perch
XP_028459901 1269 TESEHKRKKLEAQLQEFMARATEAERTKGELAERSHKLQTELDNACTMLEVAEKKGLKLAKEVDKLNSKLQDSEELRQEE 1348 yellow perch
XP_004916275 1255 QDSEQRRKKLEQQVSEFQIRTNESEKVKFELAEKLQKLQAELDGVSGALGSTEGKSIKLTKDLSTVQSQLQDTQELLQEE 1334 tropical claw...
Q6URW6       1349 TRAKLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQSTQAQLSEWRRRQEEEAAVLEAGEEARRRAAREAETLTQR 1428 house mouse
XP_016851550 1354 TRQKLNLSSRVRQLEEEKAAMLEQLEEEEAAKANFSRQMQSLQQQVMETKKKLEEDAGVAEAIEEARRRAAKDLESLSVR 1433 green anole
XP_005157988 1388 TRQKLALGSRVRALEEEKAGLMERLEEEEEKTRELTRQIQNHTQQLADLKRQTEEVNSAVEAGEETRRKMQRDLENAVQR 1467 zebrafish
XP_018669542 1333 TQAKLKYAHKIRSLEDERTSLEEQLEEEEESRKAVEKQLSTANIALQDLKKKMEGDAEAIDQLEESKKRYQRELEDKTQQ 1412 vase tunicate
XP_025861267 1388 TRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLVLQSQLADTKKKVDDDLGTIESLEEARKKLLKDVEALGQR 1467 red fox
XP_024840731 1335 TRQKLNVSTKLRQLEDERNSLQEQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVELLEEGKKKFQKEIESLTQQ 1414 cattle
AAI62152     1326 TRQKLQLSTKLRQIEDDRNALQEQLDEEAEAKRNVERHVSTLNIQLSDFKKKLEEMTGNVELLEEGKKRLQRDLEAANTQ 1405 zebrafish
CAG06107     1363 TRQKLSLSTRLKQMEDEQTGLQEMLEEEEEAKRTVEKQISTLNAQLSEMKKKVEQEALSLEAAEEDRKRLKSESDALRLQ 1442 spotted green...
XP_023268550 1325 TRQKLSISSRLRQLEDEQNSLRELLEEEEEGKKNVEKQVSTLQAQLAEMKKKLEQESMSLEGAEECRKRVQREVDSTMQQ 1404 Seriola lalan...
TNN57866     1305 TRQKLSNSTRLRQLEDEQNNLREQLEEEEETKRNVEKHLQTVQAQLLEMKKKFEQDAGCLESAEEGKKRLQRDLEGLSQR 1384 Tanaka's snai...
TDH03366     1405 TRQKLNLSGRLRQTEEDRNSLMEQLEEETEAKRAVERQVSSLNMQLSDSKKKLDEMSGTVEALEEGKKRLQRELEAANSD 1484 yellow perch
XP_028459901 1349 TRQKLNLSTQIRQLEVDRNTLLEQQEEEEEARRNLEKQLQMVQSQMFETKKKLEEDLGSMEGLEEVKRKLQKDVELTSQC 1428 yellow perch
XP_004916275 1335 TRQKLNFSSRVRQLEEEKNNLMENLEEEESAKAQLSRQLQALQQQLLESKKRMEDQGGMVEAMEEAKKKSYKELEFLQQR 1414 tropical claw...
Q6URW6       1429 LAEKTEAVERLERARRRLQQELDDATVDLGQQKQLLSTLEKKQRKFDQLLAEEKAAVLRAVEDRERIEAEGREREARALS 1508 house mouse
XP_016851550 1434 YEERVQACDKLEKGRTRLQQELDDVTVALDQQRQVVSALEKKQKKFDQMLAEEKLISARYAEERDRAEADAREKETKVLS 1513 green anole
XP_005157988 1468 EKSKEEEKERIERQKERLREEIEDMTIALQRERQNCTALEKRQKKFDQCLAEEKAVSARLQEERDRAEAESREKETRFLS 1547 zebrafish
XP_018669542 1413 LEEKSAQADKLEKTNKRLQGDYDDLSVEVDHNRSVISSLEKKQRQFDKALADERMISAKNAEERDQAEREAREKDTKAIS 1492 vase tunicate
XP_025861267 1468 LEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQIASNLEKKQKKFDQLLAEEKNISARYAEERDRAEAEAREKETKALS 1547 red fox
XP_024840731 1415 YEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALS 1494 cattle
AAI62152     1406 FEEKAAAYDKLEKTKNRLQQELEDTLMDLDNQRQLVSNLEKKQKKFDQMLAEEKSISSKYADERDRAEAEAREKETKALS 1485 zebrafish
CAG06107     1443 LEEKEAAYEKLEKTKTRLQQELDDLLVNQDSQRQLVNNMEKKQRKFDQMLAEEKAISNQRADERDRAEADAREKETRALT 1522 spotted green...
XP_023268550 1405 LEEKTAAYDKLDKTKTRLQQELDDLLVDQDHLRQIVSNLERKQKKFDQMLAEEKTISTQYAEERDKAEAEAREKETRALT 1484 Seriola lalan...
TNN57866     1385 MEEKCSAFEKLDKTKTRVQQELDDLLVDQDHLRQIVSNLEKKQKKFDQMLAEEKNISARYAEERDKAEAEAREKDTRALA 1464 Tanaka's snai...
TDH03366     1485 YEEKASAYDKLEKSRGRMQQELEDVLMDLDSQRQLVSNLEKKQKKFDQMLAEERAVSCKFAEERDRAEAEAREKETRVLA 1564 yellow perch
XP_028459901 1429 LEEKTMAMDKMEKTKNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQLLAEEKTISAQYAEERDRAEAEAREKDTKALS 1508 yellow perch
XP_004916275 1415 FDEKHQINDKLEKTRNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFDQMLAEEKNISARYGEERDRAEAEAREKETKALS 1494 tropical claw...
Q6URW6       1509 LTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKNVHELERARKAAEQAASDLRTQVTELEDELTAAEDAKLRLEV 1588 house mouse
XP_016851550 1514 LSRALEEALETREEMERQNKQLRAEMDDLVSSKDDVGKNVHELERFKRALEQQVQEMRAQMEELEDELQATEDGKLRLEV 1593 green anole
XP_005157988 1548 LSRALQEATEQRDELERTNKQLRLEMEQLVNAQDDVGKNVHELERSRRALETEAQSLKEQTQELEDELGEAENARLRLEV 1627 zebrafish
XP_018669542 1493 LSHECDELKDKIDELERVRRSQQAELDELVSSKDATGKSAHELERSKRLLESQMEEMKTQLEELEDELQVTEDAKLRLEV 1572 vase tunicate
XP_025861267 1548 LARALEEALETKEEFERQNKQLRADMEDLISSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEV 1627 red fox
XP_024840731 1495 LARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEV 1574 cattle
AAI62152     1486 LARALEEAQEAREEFERANKALRAEMEDLVSSKDDVGKNVHELEKSKRGLEAQVEEMKTQLEELEDELQAAEDAKLRLEV 1565 zebrafish
CAG06107     1523 LSRELEDLRDHKKDLEEANRLLKAEMEDLISSKDDAGKNVHELERSKRAMEQQLAEMKTQLEELEDELQATEDAKLRLEV 1602 spotted green...
XP_023268550 1485 LARELETMTDLKNELDRANKLLKAEMDDLVSSKDDVGKSVHELERSKRAMEQQLEEMRVQLEELEDELQATEDAKLRLEV 1564 Seriola lalan...
TNN57866     1465 LTRELDSMMDIKDEVDRNNKLLRAEMEDLVSSKDDVGKSVHELEKAKRAMEQQLEEMKTQLEELEDELQGTEDAKLRLEV 1544 Tanaka's snai...
TDH03366     1565 LARALEENQGALEEAEKTMKGLRADMEDLISSKDDVGKSVHDLEKAKRGLEAIVDEMRTQMEELEDELQVAEDAKLRLDV 1644 yellow perch
XP_028459901 1509 MARALEEALEAKEELERFNKQLRAEMEDLMSSKDDVGKNVHELEKSKRTLEQQVEEMRTQLEELEDELQATEDAKLRLEV 1588 yellow perch
XP_004916275 1495 LSRALEEAIDLKDELDRQNKQLRAEMDDLVSSKDDVGKNVHELERSKRALEQQVQEMKTQIEELEDELQAIEDGKLRLEV 1574 tropical claw...
Q6URW6       1589 TVQALKAQHERDLQGRDDAGEERRRQLAKQLRDAEVERDEERKQRALAMAARKKLELELEELKAQTSAAGQGKEEAVKQL 1668 house mouse
XP_016851550 1594 NMQALKAQHERELQNRDDANDDKKKLLSKQVRELEAELDAERKQRAQALAGRKKLELDLQEAMAQLDAANKGRDEAGKQL 1673 green anole
XP_005157988 1628 TLQALRAQFEREISTKEEKGEEKRRALNKQVRELETMLEEEKTQRAQALTVKKQLETELQEAEAQVEAANRGREEAFRQM 1707 zebrafish
XP_018669542 1573 NLQAAKTNFERDLNAREEQAEEKRRSILKQLRELEAELEEERKQKSNAIAAKKKMEMDFSDLESHIDAASKGKEDAVKQL 1652 vase tunicate
XP_025861267 1628 NMQAMKAQFERDLQTRDEQNEEKKRLLVKQVRELEAELEDERKQRALAVASKKKLEIDLKDLEAQIEAANKARDEVIKQL 1707 red fox
XP_024840731 1575 NMQALKVQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAVAAKKKLEGDLKDLELQADSAIKGREEAIKQL 1654 cattle
AAI62152     1566 NMQALKAQFERDLQGRDEQGEEKKRQLVKQVRELETELEDERKQRTALAASKKKLEGDLKDLEGQIETSNKGRDEAIKQL 1645 zebrafish
CAG06107     1603 NMQAMKAQFDRDLQARDEQGEERRKQLVKQVHEFEAELEDERRQRSQAVSAKKKLELDLGELEAHINDANKGREEALKQL 1682 spotted green...
XP_023268550 1565 NMQAMKAQFDRDLQARDEQGEERRKQLVKQVREMEIELEDERKQRTQALSSKKKLEMDLMELEVQIDAANKGRDEALKQL 1644 Seriola lalan...
TNN57866     1545 NMQAMKAQYERDLSGRDEMGEEKKRALVKQVREMEMELEDERKQRSAAVAGRKKLELDLKELEAGIDMANKNRDEALKQL 1624 Tanaka's snai...
TDH03366     1645 NTQALRAQHERELHARDELGEEKRKQLLKQVRELEAELEEERKQRGQASGSKKKLEGELKDMEDQLEATSRGRDEAVKQL 1724 yellow perch
XP_028459901 1589 NMQAMKAQFDRDLQARDEQGEEKKRLLVKQVREMEAELEDERKQRTLAVASKKKLEMDLNELEGQIEAANKGRDEAVKQL 1668 yellow perch
XP_004916275 1575 NMQAMKAQFERDLQNRDDSNDEKKKLLFKQVREMEVELEEERKQKSQILVAKKKLEMDLQDMESQMDSANKGRDEAVKQL 1654 tropical claw...
Q6URW6       1669 KKMQVQMKELWREVEETRSSRDEMFTLSRENEKKLKGLEAEVLRLQEELAASDRARRQAQQDRDEMAEEVASGNLSKAAT 1748 house mouse
XP_016851550 1674 RKLQAQMKELWREVEEARAAREEIFIQSRESEKKLKNLEAELLQLQEDLAASERAKRQAQQERDDLADELANGNSGKSAL 1753 green anole
XP_005157988 1708 KRLQTQMKELIRELDETKLARDEIVAQSKDSEKRLQTLEAELLQLTEDLSVSERQKRQAQQERDEMADEIINNATGKSAL 1787 zebrafish
XP_018669542 1653 KKAQAQLKEYQRDLDEVRQSRDDLLITSRESDKKAKNLEADLMQAQEDLSASERHRRTVEAERDELQEEIAGGLKDKNAQ 1732 vase tunicate
XP_025861267 1708 RKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSAL 1787 red fox
XP_024840731 1655 RKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKDELAEELASSVSGRNAL 1734 cattle
AAI62152     1646 RKLQAQMKDFQRELDDAHAAREEVLSSAKENERKAKTLEAELLQLQEDLAAAERAKKQVEAERDELADELASNASGKSAL 1725 zebrafish
CAG06107     1683 KKLQAQFKDLARECDELRLSRDEALNCSKETERKLKSMEAETLQFQEDLASADRLKRQIQTERDELQDEVKDGNAKNSIL 1762 spotted green...
XP_023268550 1645 KKLQALMKEHMRELEELRLSRDEAVSGAKETERKLKAMEADALHFQEDLATAERLKRQVQTERDELQDEINSSNSKNSLL 1724 Seriola lalan...
TNN57866     1625 KKLQAQMKDLIRELEDTRMSREEILAQSKETEKKLKGMEAEMIQMQEELAAAERVKRQAQQERDELQDEINNQATKNALV 1704 Tanaka's snai...
TDH03366     1725 RKIQGQVKDLQRDLEDSRAAQKEVLASARESERRSKAMEADIVQLHEMLAAVERARKQAEVERDELSEELASNsSGKSLM 1804 yellow perch
XP_028459901 1669 RKLQAQMKDYQRELEEARASRDEIFTQSKENEKKLKGLEAEILQLQEDHAASERARRHAEQERDELADEISNSASGKSSL 1748 yellow perch
XP_004916275 1655 KKLQLQFKEVWREVEETRAARDEIFVQSRDNEKKLKSLEAELLQLQEDLAAAERAKRQAQQERDDLADELSNGVSGKSAL 1734 tropical claw...
Q6URW6       1749 LEEKRQLEGRLSQLEEELEEEQNNSELLKDHYRKLVLQVESLTTELSAERSFSAKAESGRQQLERQIQELRARLGEEDAG 1828 house mouse
XP_016851550 1754 LDEKRHLEARIGQLEEELDEEQSNMELLNDRYRKLSMQVETLTTELGAERSFSQKTENARQQLERQNKDLRAKLGEMDSS 1833 green anole
XP_005157988 1788 FDEKRRLETRITQMEEELEEAQSNAELLAERQRKSTLQIETLTVQLSGERTLAQKSESARETLERQNKELKTRLSEMEGA 1867 zebrafish
XP_018669542 1733 QDDKRRIEARIADMEEENEDLASTVEILDEKNRKLQSQNEQLQNELSSERSSLQKQESAKSHLERQNKELKLKLSEMEQT 1812 vase tunicate
XP_025861267 1788 LDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGA 1867 red fox
XP_024840731 1735 QDEKRRLEARIAQLEEELEEEQGNTEAMSERVRKATQQAEQLSNELATERSAAQKNENARQQLERQNKELRSKLQEMEGA 1814 cattle
AAI62152     1726 SDEKRRLEAKIQQLEEELEEEQGNMEMLNDRLRKSAQQVDQLTNELQAERTTSQKNESARQLMERQNKELKAKLQEMENQ 1805 zebrafish
CAG06107     1763 QEDKRRLDDQIAQLKEELEEEQLNTEMSNERYKRAAQQCDQLNAELTSERSHSQQLEGARSQAERKNKELSLKLQELEST 1842 spotted green...
XP_023268550 1725 ADDKRRLEARITQLEEELEEEQLNTEMVNDRLRRTTLQTEQLTTELAGERSSSQRLEGARSQMDRQNKELKLKLQELEGT 1804 Seriola lalan...
TNN57866     1705 AEEKRRLEARIAQLEEELEEEQCNTELTNDRLKKAVLQTDQMNVELTAERSTCQRVEGARCQLERQNKELKLKLQELEGT 1784 Tanaka's snai...
TDH03366     1805 SDEKRRLDTKISQLEEELEEEQANVESLNDRLRKSQQLVEQLGAELAAERSTSQSREGSRQQLERQNRELKAKMQEMEGQ 1884 yellow perch
XP_028459901 1749 LEEKRRLEARIAQLEEELEEEQGNMELLNDRFRKSNIQVDNLNTELAGERSAAQKSENARQQMERQNKDLKAKLAELEGT 1828 yellow perch
XP_004916275 1735 LDEKRALEMRISQLEEELDEEQSNTELINDRYRKLTLQVETITTELSAERSFSQKAENARQQMERQNKELKVKLNEMDST 1814 tropical claw...
Q6URW6       1829 ARARQKMLIAALESKLAQAEEQLEQESRERILSGKLVRRAEKRLKEVVLQVDEERRVADQVRDQLEKSNLRLKQLKRQLE 1908 house mouse
XP_016851550 1834 VKSKYKMAIATLESKVAQLEEQLEQESRERILSGKLVRRAEKKLKEVILQVDEERRNADQYKDQVEKGHLRLKQLKRQLE 1913 green anole
XP_005157988 1868 VKGKHRLSVAALEAKIESMEEQVEQERQERAMANKLVRKTEKKLKEVLMQVEDERRHADQYREQLDKSMGRLRQLKRQLE 1947 zebrafish
XP_018669542 1813 VRTKQKNAIAALEAKILSTEEQLEAEAKERSAANKLLRRSEKKLKETLLLVDDERNHADQYKEQVDKVSSRVKALKRQLD 1892 vase tunicate
XP_025861267 1868 VKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLE 1947 red fox
XP_024840731 1815 VKSKFKSTIAALEAKIAQLEEQVEQEAREKQATAKALKQKDKKLKEALLQVEDERKMAEQYKEQAEKGNLRVKQLKRQLE 1894 cattle
AAI62152     1806 VKSKFKSSISALEAKVAQLEEQLEQESRDKQNTAKAVRQKDKKLKEMMTQVEDERKQAEQYKDQADKATARVKQLKRQLE 1885 zebrafish
CAG06107     1843 IKSKYKSSISSLEAKVAQLEEQLDAEIRERQQASRTVRRSEKKLKELLIQVEDERRNSEQYKDQADKLNSRMRQLKRQLE 1922 spotted green...
XP_023268550 1805 IKSKYKSSITTLEAKIAQLEEQLDVESKERQQASRLARRTEKKLKEVLLQVDDERRNTEQYKDQAEKTNNRMRQLKRQLE 1884 Seriola lalan...
TNN57866     1785 VKSKYKANMAALESKIVAVEEQLDMETRERQGATKLVRRTEKKLKEVILQVDDERRNTEQYKDQVDKLNSRMKQLKRQLE 1864 Tanaka's snai...
TDH03366     1885 GRSKLKASIAALEAKLREAEEQLEIESRERQANGKNLRQKEKKLKDLTIQMEDERKQAQQYKDQAEKGNVRVKQLKHQLE 1964 yellow perch
XP_028459901 1829 VKSKFKASIAALEAKILQLEDQLEQEAKERAAANKIVRRTEKKLKEVMMQVEDERRHADQYKEQMEKANSRMKQLKRQLE 1908 yellow perch
XP_004916275 1815 MRSKYKITIASLEAKISQLEEQMEQESKERIIANKLVRRAEKRLKEVLLQVEEERRNADQFKEQLEKANIRMKQLKRQLE 1894 tropical claw...
Q6URW6       1909 EAEEEASRAQAGRRRLQRELEDVTESAESMNREVTTLRNRL 1949 house mouse
XP_016851550 1914 EAEEEASRANASRRRMQRELEDVTESAESMNREVTSLRNRL 1954 green anole
XP_005157988 1948 EVEEENSRSNAQRRKLQRELEEMSDSMQSMNRELNTLRSQL 1988 zebrafish
XP_018669542 1893 DAEEEVSRANAAKRKIQRDLDDTTEQNETLHREVSQLRNKL 1933 vase tunicate
XP_025861267 1948 EAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRL 1988 red fox
XP_024840731 1895 EAEEESQRINANRRKLQRELDEATESNEAMGREVTALKSKL 1935 cattle
AAI62152     1886 ESEEESQRITAARRKLQRELDEATETNDAMSREVNSLKSKL 1926 zebrafish
CAG06107     1923 EAEEEVTRANAYRRKLQRELDDASETADAMNREVSTLKSKL 1963 spotted green pufferfish
XP_023268550 1885 EAEEEVTRANAYRRKLQRELDDAAESADLMNREVSTLKSKL 1925 Seriola lalandi dorsalis
TNN57866     1865 EAEEEAQRANANRRKLQRELEDATESADVVNREVTTLKNKL 1905 Tanaka's snailfish
TDH03366     1965 EAEEEAQRMAAARRKLQRELDEATEANDTLSRDMASLRSKL 2005 yellow perch
XP_028459901 1909 EAEEEATRANATRRKLQRELDDATEASEGLTREVSSLKNRL 1949 yellow perch
XP_004916275 1895 EAEEEASRANSNRRRLQRELEDVTESAESMNREVTTLRSRL 1935 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap