Conserved Protein Domain Family
Nitrophorin

?
pfam02087: Nitrophorin 
Click on image for an interactive view with Cn3D
Nitrophorin
Statistics
?
PSSM-Id: 111029
View PSSM: pfam02087
Aligned: 3 rows
Threshold Bit Score: 278.018
Threshold Setting Gi: 3212694
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NP1_A        2 CTKNALAQTGFNKDKYFNGdVWYVTDYLDLEPDdVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQEESPG- 80
gi 74834284  25 CSTNISPKKGLDKAKYFSG-TWYVTHYLDKDPQ-VTDPYCSSFTPKESGGTVKEALYHFNSKKKTSFYNIGEGKLGSAGv 102
2AH7_X        3 CSTNISPKQGLDKAKYFSG-KWYVTHFLDKDPQ-VTDQYCSSFTPRESDGTVKEALYHYNANKKTSFYNIGEGKLESSGl 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2NP1_A       81 KYTANFKKVEKNGNVKVDVTSGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDTNAGDKVKGAVTAASLKF 160
gi 74834284 103 QYTAKYNTVDKKRKEIEPADPKDSYTLTVLEADDSSALVHICLREGPKDLGDLYTVLSHQKTGEPSATVKNAVAQAGLKL 182
2AH7_X       81 QYTAKYKTVDKKKAVLKEADEKNSYTLTVLEADDSSALVHICLREGSKDLGDLYTVLTHQKDAEPSAKVKSAVTQAGLQL 160
                       170       180
                ....*....|....*....|.
2NP1_A      161 SDFISTKDNKCEYDNvSLKSL 181
gi 74834284 183 NDFVDTKTLSCTYDD-QFTSM 202
2AH7_X      161 SQFVGTKDLGCQYDD-QFTSL 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap