Conserved Protein Domain Family
FliM

?
pfam02154: FliM 
Click on image for an interactive view with Cn3D
Flagellar motor switch protein FliM
Statistics
?
PSSM-Id: 111086
View PSSM: pfam02154
Aligned: 7 rows
Threshold Bit Score: 257.305
Threshold Setting Gi: 300680950
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4GC8_A        15 YDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMGGTGVLE 94
gi 300680950  77 RAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPGILAVFRAEELDNYGLLT 156
gi 120345     38 YDPNTQRRVVRERLQALEIINERFARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVV 117
gi 120344     40 YDFKRALRFSKDQIRSLTRIHDNFARLLTTHFSAQLRTYIHISVSSVDQVPYEEFIRSIPNMTILNLFDVHPMEGRIMME 119
gi 6225364    39 YDFRRPDKFSKEQMRTLSLMHETFARLTTTSLSAQLRSMVHVHVASVDQLTYEEFIRSIPTPSTLAVITMDPLKGNAVLE 118
gi 3913687    49 YDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIINMDPLKGSAIFE 128
gi 588746822  37 FDFSSQDRIVRGRMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALIT 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4GC8_A        95 INPSIAFPMIDRLLGGKGSAYD---QNREFSDIELNLLDTILRQVMQILKEVWSPVVEMFPTIDAKESSANVVQIVA-QN 170
gi 300680950 157 VDSNLIYSIVDVLLGGRRGTAAmriEGRPYTTIERVLVQRMIDVVLHDLKSAFEPLHPVSFSLDRLETNPPFAAIAR-PA 235
gi 120345    118 FSPSLVFIAVDNLFGGDGRFPTk-vEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSEMQVKFTNITTsPN 196
gi 120344    120 VNPTIAYTMMDRVMGGIGISHN---KVDSLTEIETKIISNLFENALGNYKEAWQSIADIEPEMTEFEVNPQFVQMVS-PN 195
gi 6225364   119 VDPSITFSIIDRLFGGTGQAAK---VQRDLTDIENSVMEGVIVRILANVRESWTQVIDLRPRLGQIETNPQFAQIVP-PS 194
gi 3913687   129 VDPTIAFAIVDRLFGGDGDTIKd--KSRDLTEIEQSVMESVIIRILANMREAWSQVVDLRPRFGHIEVNPQFAQIVP-PT 205
gi 588746822 117 MEARLVFILVENFFGGDGRFHAk-iEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVEFEYLDSEVNPSMANIVS-PT 194
                        170       180       190
                 ....*....|....*....|....*....|....*
4GC8_A       171 EISIMVVLEIIIGHSRGMMNICYPVISIESILSKM 205
gi 300680950 236 NAAILVKLRIDMEDRGGRIELLLPYATLEPIRKML 270
gi 120345    197 DIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELL 231
gi 120344    196 ETVVVISLNTQIGEISGVINLCIPHIVLEPLIPKL 230
gi 6225364   195 EMVVLVTLETKVGEEEGMMNFCIPYITIEPIISKL 229
gi 3913687   206 EMIILVTLEVKIGKVEGLMNFCLPYITIEPIVSKL 240
gi 588746822 195 EVIVVSSFHIEVDGGGGDFHVVMPYSMVEPIRELL 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap