Conserved Protein Domain Family
HAT

?
pfam02184: HAT 
Click on image for an interactive view with Cn3D
HAT (Half-A-TPR) repeat
The HAT (Half A TPR) repeat is found in several RNA processing proteins.
Statistics
?
PSSM-Id: 111114
View PSSM: pfam02184
Aligned: 3 rows
Threshold Bit Score: 55.2644
Threshold Setting Gi: 74956757
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30
                ....*....|....*....|....*....|...
3JB9_R      185 HENERARGIYERFVVVH-PEVTNWLRWARFEEE 216
gi 17380353 191 KEIDRAREIYERFVYVH-PDVKNWIKFARFEES 222
gi 74956757 201 KEIDRARSVYQRFLHVHgINVQNWIKYAKFEER 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap