Conserved Protein Domain Family
PRRSV_Env

?
pfam02340: PRRSV_Env 
PRRSV putative envelope protein
This family consists of a conserved probable envelope protein or ORF2 in porcine reproductive and respiratory syndrome virus (PRRSV) also in the family is a minor structural protein from lactate dehydrogenase-elevating virus.
Statistics
?
PSSM-Id: 111251
View PSSM: pfam02340
Aligned: 4 rows
Threshold Bit Score: 339.601
Threshold Setting Gi: 81925652
Created: 16-Jul-2016
Updated: 11-Dec-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81922060  19 MLSRSSWCPLLISLYFWPFCLASPSPVGWWSFASDWFAPRYSVRALPFTLSNYRRSYEAFLSQCQVDIPTWGTKHPLGML 98
gi 418583    16 TPSLSSLLVWLILPFSLPYCLGSPSQDGYWSFFSEWFAPRFSVRALPFTLPNYRRSYEGLLPNCRPDVPQFAVKHPLGMF 95
gi 81925652   1 MRLYNLLCPYLTSWFFLVFCLALPSPAGCWFGLSDWFSPRSTVRVEKMTSLTFRSYFRDAIKLCRPDVIHFG-KG-FGLL 78
gi 82010987   1 MHLFSSLFPSLIFWFSWAFFLGLPSPAGCWFGVSDWFSPRYSVRVERLTSLTYRRYFRDAIKLCQPDAIHYG-KG-FGML 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81922060  99 WHHKVSTLIDEMVSRRMYRIMEKAGQAAWKQVVSEATLSRISSLDVVAHFQHLAAIEAETCKYLASRLPMLHNLRMtGsN 178
gi 418583    96 WHMRVSHLIDEMVSRRIYQTMEHSGQAAWKQVVGEATLTKLSGLDIVTHFQHLAAVEADSCRFLSSRLVMLKNLAV-G-N 173
gi 81925652  79 WHMKVATMLDDVIHSRLMSHMSHQGRETWGQIFTHKALENIATPTFCPISSQMAGLEREACTYLLSRLPAIQAASAvY-N 157
gi 82010987  79 WHMKIATMLDDVIHSRLMSHMSHQGRETWGRVFTQKALENIGRTQVVSHLQQIAGLEREACTYLMSRLPAIQAASAvY-N 157
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 81922060 179 VTIVYNSTLNQVFAIFPAPGSRPKLHDFQQWLIAVHSSIFSSVAASCTLFVVLWLRVPILRTVFGFRWLGATFLS 253
gi 418583   174 VSLQYNTTLDRVELIFPTPGTRPKLTDFRQWLISVHASIFSSVASSVTLFIVLWLRIPALRYVFGFHWPTATHHS 248
gi 81925652 158 VTIKF---LNQTVLIDFGPSNSSLSVAEHLWLVSMQSSVFSSVSAAVALWIVMLLRLP--KRVFGFPFMKRARRI 227
gi 82010987 158 VTIKF---SNETIAISFGPSNTSLTVAEHLWLVSMQSSVFSSVAAAFALWIVMLLRLP--RSVFGFLSMRRVRRT 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap