Conserved Protein Domain Family
Adeno_E3_CR2

?
pfam02439: Adeno_E3_CR2 
Adenovirus E3 region protein CR2
Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host. This region called CR2 (conserved region 1) is found in Adenovirus type 19 (a subgroup D virus) 49 Kd protein in the E3 region. CR2 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 50 amino acid region is unknown.
Statistics
?
PSSM-Id: 111345
View PSSM: pfam02439
Aligned: 9 rows
Threshold Bit Score: 35.0115
Threshold Setting Gi: 119073
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*....
gi 75554841  349 IPSATVTIVVGVIAGFVTLIIVFICYICCRKRPRAYnYM 387
gi 75564813  370 IPSTTVAIVVGVIAGVITIIIVILCYICRRKRPRAYnHM 408
gi 544214    143 ISTSTISIIAAVTIGISILVFTITYYACCYRKDK-H-KG 179
gi 81944764  153 IPKSMIGIIVAVVVCMLIIALCMVYYAFCYRKHRLNdKL 191
gi 82010618  179 IPRSMIGIIAAVVVCMVIIILCMMYYACYYRKHRLNnKL 217
gi 123832913 135 IPNSMIAIIAAVALGMALIIICMFLYACCYKKFQ-H-KQ 171
gi 119073    136 IPDSMIAIVAAVAVVMALIIICMLLYACRYKKFHPK-KQ 173
gi 81944763  159 CPGLLVSGIVGVLSGLAVIIICMFIFACCYRRLYRQ-KS 196
gi 6492011   145 IPKSTIGIITAVVVGLIIIFLCIMYYACCYRKHE-Q-KG 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap