Conserved Protein Domain Family
Sigma_1s

?
pfam02454: Sigma_1s 
Sigma 1s protein
The reoviral gene S1 encodes for haemagglutinin (sigma 1 protein), an outer capsid protein and a major factor in determining virus-host cell interactions. Sigma 1s is one of two translation products of the S1 gene.
Statistics
?
PSSM-Id: 111360
View PSSM: pfam02454
Aligned: 5 rows
Threshold Bit Score: 140.051
Threshold Setting Gi: 141409
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 418307     3 NQPTRNTRSRKLRNKLKTSLLMSTGSVTSLIQSKDNWVDYLYACQPLNRELVRTAIELIDSSEMSPAYRLALAESIRVYP 82
gi 75568816   5 CQKGLNRGSRRLRKRPKYTLIQSSGSLRDSMMQINESSLLSKVGTIWLHQLVTRNLQSPDWKALSEPSKQLSMDLIRVLP 84
gi 75568811   5 CQRALNQGSKRSRKRPKYTLIQSLGLLKDSMTQTNESSLLSKVGTIWLHQSVMRNLQSPDWKALSEPSKQLSMDLIQVLP 84
gi 75568809   5 CQKGLNQGSRRSRRRLKYTLILSSGSPRDSMMQTNESSLLSKVGMTWLHQSVMLNLQSPDWKALPEPSKQLSMDLIRVLP 84
gi 141409     1 MAPS-QKKSRKSRNKSRSTLMISGLPILNSTDLEDRLLTSAIASQPLSQDWVRWIIDLWVSRVRSRNYLTQVARTLRAYP 79
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
gi 418307    83 SWVTESMLQNSELASWIQSRIISLsehQDWKLKYqpllMTLDH 125
gi 75568816  85 SWVVEWDSLRQDLQDYAMTTAVSL---REWVHRN----ATLDH 120
gi 75568811  85 RLVAEWENLRQDLQDYALTMTVSL---REWILRN----VTLDH 120
gi 75568809  85 NWVLEWDNLRQDLQSYALTTTISL---REWILRN----VTLDH 120
gi 141409    80 HWVTESMLSNHELTVWIRSRLISL---DEHPLWR----QMLEA 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap