Conserved Protein Domain Family
Arteri_GP4

?
pfam02497: Arteri_GP4 
Arterivirus glycoprotein
This is a family of structural glycoproteins from arterivirus that corresponds to open reading frame 4 (ORF4) of the virus.
Statistics
?
PSSM-Id: 111400
View PSSM: pfam02497
Aligned: 3 rows
Threshold Bit Score: 267.205
Threshold Setting Gi: 81925654
Created: 14-Jul-2016
Updated: 11-Dec-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81922062   1 MASSLLFLVVGFKCLLVSQAFACKPCFSSSLADIKTNTTAAASFAVLQDISCLR-HRDSASeai---rkIPqCRTAIGTP 76
gi 81925654   6 IYPTLVFILVGFECFLFSQALHCRPCYTKAVSVLNHSNIPLGNGLLMHTQGCHM-KRSRGG--------DP-CYTWIGQG 75
gi 418585     1 MAAATLFFLAGAQHIMVSEAFACKPCFSTHLSDIETNTTAAAGFMVLQDINCFRpHGVSAAqekisfgkSSqCREAVGTP 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81922062  77 VYVTITANVTDENYLHSSDLLMLSSCLFYASEMSEKGFKVVFGNVSGIVAVCVNFTNYVQHVKEFTQRs-lVVDHVRLLH 155
gi 81925654  76 EGVGINFNYTGAGHDHVANLVTLAACLIHAVELKETGFHPQFFNVSGHLAVCVNFTEYVSHVQNKTWH---EALKLRPAH 152
gi 418585    81 QYITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHVTQHTQQhhlVIDHIRLLH 160
                       170       180
                ....*....|....*....|...
gi 81922062 156 FMTPETMRWATVLACLFAILLAI 178
gi 81925654 153 FLSPSVVKWGTVITLVLAVLLAL 175
gi 418585   161 FLTPSAMRWATTIACLFAILLAI 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap