Conserved Protein Domain Family
VacA

?
pfam02691: VacA 
Vacuolating cyotoxin
This family consists of Vacuolating cyotoxin proteins form Proteobacteria. These proteins are an important virulence determinate in H. pylori and induce cytoplasmic vacuolation in a variety of mammalian cell lines.
Statistics
?
PSSM-Id: 111576
View PSSM: pfam02691
Aligned: 2 rows
Threshold Bit Score: 1697.99
Threshold Setting Gi: 2499108
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109   43 AFFTTVIIPAIVGGIATGAAVGTVSGLLSWGLKQAEQANKAPDKPDKVWRIQAGRGFDNFPHKQYDLYKSLLSSKIDGGW 122
gi 2499108   34 AFFTTVIIPAIVGGIATGTAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYKSLLSSKIDGGW 113
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  123 DWGNAARHYWVKDGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDGANRTTRVNFDAK 202
gi 2499108  114 DWGNAATHYWIKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAK 193
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  203 NILIDNFVEINNRVGSGAGRKASSTVLTLKSSEKITSRENAEISLYDGATLNLVSssNqSVDLYGKVWMGRLQYVGAYLA 282
gi 2499108  194 NILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNLAS--N-SVKLNGNVWMGRLQYVGAYLA 270
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  283 PSYSTIDTSKVQGEMNFRHLAVGDQNAAQAGIIANKKTNIGTLDLWQSAGLSIITPPEGGYESKTKDNP----------- 351
gi 2499108  271 PSYSTINTSKVTGEVNFNHLTVGDHNAAQAGIIASNKTHIGTLDLWQSAGLNIIAPPEGGYKDKPNNTPsqsgakndkqe 350
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  352 --QN-------NPKNDAQKTEIQPTQVIDGPFAGGKDTVVNIFHLNTKADGTLRAGGFKASLSTNAAHLHIGEGGVNLSN 422
gi 2499108  351 ssQNnsntqviNPPNSTQKTEVQPTQVIDGPFAGGKDTVVNIDRINTKADGTIKVGGFKASLTTNAAHLNIGKGGVNLSN 430
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  423 QASGRTLLVENLTGNITVEGTLRVNNQVGGAAIAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTANFNGnI 502
gi 2499108  431 QASGRTLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGVDTKNGTATFNNDISLGRFVNLKVDAHTANFKG-I 509
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  503 YLGkstnlrvNGhtahfknidatksdnGLNtsTLDFSGVTDKVNINKLTTAATNVNIKNFDIKELVVTTRVQSFGQYTIF 582
gi 2499108  510 DTG-------NG---------------GFN--TLDFSGVTNKVNINKLITASTNVAVKNFNINELIVKTNGVSVGEYTHF 565
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  583 GENIGDKSRIGVVSLQTGYSPAYSGGVTFKGGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNN 662
gi 2499108  566 SEDIGSQSRINTVRLETGTRSIFSGGVKFKSGEKLVIDEFYYSPWNYFDARNIKNVEITRKFASSTPENPWGTSKLMFNN 645
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  663 LTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKE 742
gi 2499108  646 LTLGQNAVMDYSQFSNLTIQGDFINNQGTINYLVRGGKVATLNVGNAAAMMFNNDIDSATGFYKPLIKINSAQDLIKNTE 725
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  743 HVLVKARNIDYNLVGVqGASydniSASNTNLQEQFKERLALYNNNNRMDTCVVRkdNLNDIKACGMAIGNQSMVNNPENY 822
gi 2499108  726 HVLLKAKIIGYGNVST-GTN----GISNVNLEEQFKERLALYNNNNRMDTCVVR--NTDDIKACGMAIGNQSMVNNPDNY 798
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  823 KYLEGKAWKNTGINKTANNTTIAVN-LGnNSTPTNSTTDTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDF 901
gi 2499108  799 KYLIGKAWKNIGISKTANGSKISVYyLG-NSTPTENGGNTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDF 877
                       890       900       910       920       930       940       950       960
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499109  902 GTIESVFELANRSSDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITQQLNAATTTLNNIASLEHKTSGL 981
gi 2499108  878 GTIESVFELANRSKDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITKQLNTATTTLNNIASLEHKTSSL 957
                       970       980       990      1000
                ....*....|....*....|....*....|....*....|..
gi 2499109  982 QTLSLSNAMILNSRLVNLSRKHTNHIDSFAKRLQALKDQRFA 1023
gi 2499108  958 QTLSLSNAMILNSRLVNLSRRHTNNIDSFAKRLQALKDQRFA 999
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap