Conserved Protein Domain Family
Peptidase_S29

?
pfam02907: Peptidase_S29 
Click on image for an interactive view with Cn3D
Hepatitis C virus NS3 protease
Hepatitis C virus NS3 protein is a serine protease which has a trypsin-like fold. The non-structural (NS) protein NS3 is one of the NS proteins involved in replication of the HCV genome. NS2-3 proteinase, a zinc-dependent enzyme, performs a single proteolytic cut to release the N-terminus of NS3. The action of NS3 proteinase (NS3P), which resides in the N-terminal one-third of the NS3 protein, then yields all remaining non-structural proteins. The C-terminal two-thirds of the NS3 protein contain a helicase. The functional relationship between the proteinase and helicase domains is unknown. NS3 has a structural zinc-binding site and requires cofactor NS4A.
Statistics
?
PSSM-Id: 111760
View PSSM: pfam02907
Aligned: 10 rows
Threshold Bit Score: 235.016
Threshold Setting Gi: 68565638
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NS3_A        30 EGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTR 109
gi 81977645 1056 EGEVQVVSTATQSFLATCINGVCWTVFHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSMTPCTCGSSDLYLVTR 1135
gi 81921385 1057 EGEVQFLSTATQTFLGICINGVMWTLFHGAGSKTLAGPKGPVVQMYTNVDKDLVGWPSPPGKGSLTRCTCGSADLYLVTR 1136
gi 68565638  970 TGTIFRLGSLATSYMGFVCDNVLYTAHHGSKGRRLAHPTGSIHPITVDAANDQDIYQPPCGAGSLTRCSCGETKGYLVTR 1049
gi 81980388  923 pGNVMVLGTATSRSMGTCLNGLLFTTFHGASSRTIATPVGALNPRWWSASDDVTVYPLPDGATSLTPCTFQAESCWVIRS 1002
gi 81922317 1007 EGSIVVLGTSTTRSMGTCVNGVMYTTFHGSNARTLAGPVGPVNCRWWSPSDDVAVYPLPSGASCLEPCKCGTQSVWCIRN 1086
gi 81965057  992 HGNVVVLGTSTTRSMGCCVNGVVYTTYHGTNARPMAGPFGPVNARWWSASDDVTVYPLPNGASCLQACKCQPTGVWVIRN 1071
gi 81976620 1060 AGEIQVLSTVTQSFLGTSISGVLWTVYHGAGNKTLAGSRGPVTQMYSSAEGDLVGWPSPPGTKSLEPCTCGAVDLYLVTR 1139
gi 81992783 1062 TGEVQVLSTATQTFLGTTVGGVIWTVYHGAGSRTLAGAKHPALQMYTNVDQDLVGWPAPPGAKSLEPCACGSSDLYLVTR 1141
gi 81938291 1060 AGEIQILSTATQTFLATCVNGVCWTVYHGAGSKTLAGPRGPVCQMYTNVDQDMVGWPAPAGTRSYTPCTCGASDLYLITR 1139
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1NS3_A       110 HADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFV-PVESMETT 178
gi 81977645 1136 HADVIPVRRRGDGRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFI-PVESMETT 1204
gi 81921385 1137 HADVIPARRRGDTRASLLSPRPISYLKGSSGGPIMCPSGHVVGVFRAAVCTRGVAKALEFV-PVENLETT 1205
gi 68565638 1050 LGSLVEVNKSDDPYWCVCGALPMAVAKGSSGAPILCSSGHVIGMFTAARNSGGSVSQIRVR-PLVCAGYH 1118
gi 81980388 1003 DGALCHGLIKGD-KVELEEAMEVSEFRGSSGSPVLCDEGHAVGMLVSVLHSGGRVTAARFTrPWTQVPTD 1071
gi 81922317 1087 DGALCHGR-LSK-LVELDLPTEISDFRGSSGSPILCDEGHVVGMMVSVLHRGVKVTGVRYVkPWETLPKD 1154
gi 81965057 1072 DGALCHGT-LGK-VVDLDMPAELSDFRGSSGSPILCDEGHAVGMLISVLHRGSRVSSVRYTkPWETLPRE 1139
gi 81976620 1140 NADVIPARRRGDKRGALLSPRPLSTLKGSSGGPVLCPRGHAVGIFRAAVCSRGVAKSIDFI-PVEALDVV 1208
gi 81992783 1142 DADVIPARRRGDSTASLLSPRPLACLKGSSGGPVMCPSGHVAGIFRAAVCTRGVAKSLQFI-PVETLSTQ 1210
gi 81938291 1140 QADVIPARRRGDNRAGLISPRPISTLKGSSGGPLLCPSGHVVGLFRAAVCTRGVAKALDFV-PCEAMDAT 1208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap