Conserved Protein Domain Family
Lentiviral_Tat

?
pfam02998: Lentiviral_Tat 
Lentiviral Tat protein
This family contains retroviral transactivating (Tat) proteins, from a variety of Lentiviruses.
Statistics
?
PSSM-Id: 111843
View PSSM: pfam02998
Aligned: 7 rows
Threshold Bit Score: 134.949
Threshold Setting Gi: 82307146
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82307216  1 MEEAPRRYPGGNRDADgIFQYYEEWECWDWVSQRVPGDILQRWLAMLTNSQLRRKVVKEMQRWIWRNPRAPIIRNCGCRL 80
gi 82307146  2 TEELPQRREARPEERG-LSLWERERDTWQWTSIRVPGEMLQRWLAMLRLGRNRGKVYREMQKWMWRHPKATVIRPCGCRI 80
gi 549050    1 MEEVPRRQPGGLVEVEgVFQFYEDWECWDYVSQRVPGERLQRWLAMLTNNQLRRQVIREAQIWMWKHKGAAVRRNCGCRL 80
gi 82294776  2 MEEAPRRRPGGTQEIAgIFQFYEDWECWDYVSQRVPDEILQRWLAMLTNQRLRRLVITEAQKWVWRNPKAPVRKNCGCRA 81
gi 135326    2 SEELPQRRETHPEELV-RNVRERERDTWQWTSIRVPEEILQRWLAMLRSGRNRKKVYREMQKWMWIHPKGPVIRACGCRL 80
gi 82307178  2 NEEAPQRREIHQEDLV-RDIWERERDAWQWISVRAPGEVLQRWLAMLKSGRNRKRVLREMQKLMWRYPKAPVIRPCGCRL 80
gi 82283626  2 SEELPREREVSPEEAV-RNIWERERDTWQRASIRVPGETLQRWLAMLRLGRHRRKVLREMQKWMWKHPKAPVIRPCGCRL 80

               ....*..
gi 82307216 81 CNPGWGS 87
gi 82307146 81 CNPGWGT 87
gi 549050   81 CNPGWGS 87
gi 82294776 82 CNPGWGS 88
gi 135326   81 CNPGWGT 87
gi 82307178 81 CNPGWGT 87
gi 82283626 81 CNPGWGS 87
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap