Conserved Protein Domain Family
Y_phosphatase2

?
pfam03162: Y_phosphatase2 
Click on image for an interactive view with Cn3D
Tyrosine phosphatase family
This family is closely related to the pfam00102 and pfam00782 families.
Statistics
?
PSSM-Id: 111998
View PSSM: pfam03162
Aligned: 8 rows
Threshold Bit Score: 164.079
Threshold Setting Gi: 140556
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Q47_A         2 LIPPLNFSXVDN---GIFRSGFPDSANFSFLQT-LGLRSIIYLCPEpYPESNLQ--FLKSNGIRLFQFGIEGNKEP---- 71
gi 1730756    67 IVPPLNFCPVER---YLYRSGQPSPVNFPFLLN-LKLKTIIWLSNE-EPQDTLLe-FCDTHRINLQFAAINPDAGEdd-- 138
gi 74676603    3 LVTPLQFSTVQP---NLYRGSYPREINLPFLRT-LRLKYILSLTPEpLSTDPLMvkFCEENNIKTIHIKCQSERKAdktk 78
gi 74827398  398 LVPPFRFARVES---GVYRGAYPVLRNFPYIRR-LRLRTMVSLIPEpPTYDLKC--FAEAEHIQLHHIHAERAKG----- 466
gi 395398597  80 PLVPDNFGVVYPg--IIYRSACPRASNFNFLES-LHIRTIISLRQEeYSEEDLH--YFTKHHINYYHIAMPGSKHRkndc 154
gi 1730719   116 VIPPENFSHVVG---EIYRSSFPRQENFSFLHErLKLKSILVLIPEeYPQENLN--FLKLTGIKLYQVGMSGNKEP---- 186
gi 140556     62 VLRMSDFSAAAV---PVKSSSVSNANLYSNNNStLSLQEEKKKSTAnGSQNSTT--G-DPVIQEELAYHLTDNDD----- 130
gi 1730735     3 YIPPLNFSPVVStdvSLYRSGYPMPLNYSFIKHqLHLKTIIYIGDKdRPLEEYQs-FLESEKIKYYHIFMDSSRD----- 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Q47_A        72 --------FVNIPDHKIRXALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLR-KLQKWCLTSIFDEYQRFAAA-KARVSDQ 141
gi 1730756   139 ------npWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLR-RIMGWNLASVSEEYRRFTGSrGGRILVE 211
gi 74676603   79 pkikrkkkTVPIEYDVVVRCVKFLIDKGHYPCYMHCTNGELIISLVVACMR-KFSYWSTVSILNEFLVYNSS--INIHER 155
gi 74827398  467 --------EVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALR-KLLQWDANVANAEFQRFTRE---VQDEA 534
gi 395398597 155 is-sssnpDISDVDDLVRKTLQLLLNKENWPVLLHCSRGKHRTGIVIGCLR-ALMNWPVGNRLQEYISFSHP-KEREVDE 231
gi 1730719   187 --------FVNIPSHLLTKALEIVLNPANQPILIHCNRGKHRTGCLIGCIR-KLQNWSLTMIFDEYRRFAFP-KARALDQ 256
gi 140556    131 --------LMLIKSTCLKRTFKTLLNVDNYNVLLVD-----KTALVIGILR-KIQKWNIASIINEYRLFSGK-NRNYFAE 195
gi 1730735    77 ----------EGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRkLLQGWSTAGICQEYGLFSGG-MKDGVDL 145
                        170
                 ....*....|
2Q47_A       142 RFXEIFDVSS 151
gi 1730756   212 LLIEAFDTNL 221
gi 74676603  156 NFIENFNSEI 165
gi 74827398  535 AFIADYTGPL 544
gi 395398597 232 EYIQNFSSDP 241
gi 1730719   257 QFIEMYDDDE 266
gi 140556    196 TFLEIINIEI 205
gi 1730735   146 EFITMFETNL 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap