Conserved Protein Domain Family
V1R

?
pfam03402: V1R 
Vomeronasal organ pheromone receptor family, V1R
This family represents one of two known vomeronasal organ receptor families, the V1R family.
Statistics
?
PSSM-Id: 112227
View PSSM: pfam03402
Aligned: 2 rows
Threshold Bit Score: 427.464
Threshold Setting Gi: 108861969
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81917886   38 KLLGENKPKPIDLYIAFLSLTQLMLLITMGLIAVDMFMPWGRWNSTTCQSLIYLHRLLRGLALSATCLLNVLWTITLSSR 117
gi 108861969  39 KLICGQRSRLTDLPIGLLSLINLLMLLMTAFIATDTFISWRGWDDIICKSLLYLYRTFRGLSLCTSCLLSVLQAIILSPR 118
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81917886  118 SSCLTKFKHKSPHHISGAFLFFYVLYMSFSSHVLVSIIVTPNLTSEDFMYVTQSCSLLPMSYSRESRFSTLMAIRETFLI 197
gi 108861969 119 SSCLAKFKHKPSHHISCAILSLSVLYMFISSHLLVSIIATPNLTTNDFIHVTQWCSILPMSYLMQSMFSTLLAIRDVFLI 198
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81917886  198 SLMALSSGYMVALLWRHKKQAQHLRSTSLSSKASPEQRATRTIMLLTSLFVVLYILERVVFQSRLKFKDCSVFYFVHIIM 277
gi 108861969 199 SLMVLSTWYMVALLCRHRKQTRHLQGTSLSPKASPEQRATRSILMLMSLFVLMSVFDSIVCSSRTMYLNDPISYSYQLFM 278
                        250       260
                 ....*....|....*....|....*
gi 81917886  278 SHSYATVSPFVFICTEKHIIKFWES 302
gi 108861969 279 VHIYATVSPFVFIVTEKHIVNSLRS 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap