Conserved Protein Domain Family
Microcin

?
pfam03526: Microcin 
Colicin E1 (microcin) immunity protein
Statistics
?
PSSM-Id: 112349
View PSSM: pfam03526
Aligned: 3 rows
Threshold Bit Score: 68.0053
Threshold Setting Gi: 124396
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*
gi 124396    31 YYFLASDKMLYAIVISTILCPYSKYAIEHIFFKFIKKDFFRKRKNLNKCPRGKIK 85
gi 462412    31 YYFLVTDKMLYAIVISTILCPYSKYAIEHIAFNFIKKHFFERRKNLNNAPVAKLN 85
gi 81541657  27 FPSLASVNPLVVAGLSTILFPFSVKLVEDFALKYTEREFWVTG--FFSETPAKTG 79
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap