Conserved Protein Domain Family
PapG_N

?
pfam03627: PapG_N 
PapG carbohydrate binding domain
PapG, the adhesin of the P-pili, is situated at the tip and is only a minor component of the whole pilus structure. A two-domain structure has been postulated for PapG; a carbohydrate binding N-terminus (this domain) and chaperone binding C-terminus. The carbohydrate-binding domain interacts with the receptor glycan.
Statistics
?
PSSM-Id: 112444
View PSSM: pfam03627
Aligned: 4 rows
Threshold Bit Score: 383.047
Threshold Setting Gi: 75468557
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75462976   1 MKKWFPAFLF-LSLSGGNDALAGWHNVMFYAFNDYLTTNAGNVKVIDQPQLYIPWNTGSATAT--YYSCSGPEFASG--V 75
gi 75463555   1 MKKWFPAFLF-LSLSGCNDALAGWHNVMFYAFNDYSGYDSGNMTIFDRGQFTIPWKTGAASAI--YSSCQTPEFVSG--V 75
gi 75468557   1 MKKWLPAFLF-LSLSGCNDALAANQSTMFYSFNDNIYRPQLSVKVTDIVQFIVDINSASSTATlsYVACNGFTWTHG--L 77
gi 75428482   1 MKKWFPALLFsLCVSGESSA---WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVT--WNQCNGPEFADGfwA 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75462976  76 YFQEYLAWMVVPKHVYTNEGFNIFLDVQSKYGWSMENENDKDFYFFDNGYEWDTWTNNGARICFYPGNMNQLNNKFNDLV 155
gi 75463555  76 YFQEYIAWVLVPRSTQTTDRYTVFFDVYSKYGWNQENTGDYGYYYFLNGYEWDTWTSDGGRVCAPVGNTKQLSNTFNELR 155
gi 75468557  78 YWSEYFAWLVVPKHV-SYNGYNIYLELQSKGGFSLDAE-DNDNYYLTKGFAWDE-VNSSGRVCFDIGEKRSLAWSFGGVT 154
gi 75428482  76 YYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDTANLCQKPGEKKRLTEKFDDII 155
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 75462976 156 FRVFLPVDLPKGHYNFPCRYIRGIQHHYYDFWQDHYKMPYDQIKQLPATNTIDVSIDNVGECQPSTQVFNI 226
gi 75463555 156 FSLLLPADLPKGRYEVPIKYIRGIQHHYYNGWREHYKMPYSQVKQLPATNTLMLSFNNTGSCRPSAQSLEI 226
gi 75468557 155 LNARLPVDLPKGDYTFPVKFLRGIQRNNYDYIGGRYKIPSSLMKTFPFNGTLNFSIKNTGGCRPSAQSLEI 225
gi 75428482 156 FKVALPADLPLGNYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGGCRPSAQSLEI 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap