Conserved Protein Domain Family
ATP_bind_2

?
pfam03668: ATP_bind_2 
P-loop ATPase protein family
This family contains an ATP-binding site and could be an ATPase (personal obs:C Yeats).
Statistics
?
PSSM-Id: 112483
View PSSM: pfam03668
Aligned: 4 rows
Threshold Bit Score: 488.168
Threshold Setting Gi: 2811049
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 614085013  17 IDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLaagSRITQLAVVMDVRSRGFTGDLDSVRNELATR- 95
gi 1176171     1 MEIIIISGRSGAGKSVALRALEDAGYYCVDNIPLDLLPQLTDILS---QSQSSVAISLDIRNIPNSAHSLKQTLSTLQK- 76
gi 67476500    1 MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLARTLA---DREISAAVSIDVRNMPESPEIFEQAMSNLPD- 76
gi 2811049     9 IQLVIITGMSGAGKTVAIQSFEDLGYFCVDNLPPSLLPKFLELMKesnSKMSKVALVMDLRGREFFDRLIEALDEMAENp 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 614085013  96 AITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEG-IAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG 174
gi 1176171    77 HHQIKIIFLEADRATLIRRYSDSRRLHPLSLKDLSLEAaIDEEYRYLEPLIQHANLILDTTHLSTHSLAERLREFLRGNS 156
gi 67476500   77 AFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESaIDKESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKR 156
gi 2811049    89 WITPRILFLDAKDSILVTRYKETRRSHPLAATGLPLEG-IALERELLEELKGRSQIIYDTSDMKPRDLREKIVKHFATNQ 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 614085013 175 GATTSVTVESFGFKYGLPMDADMVMDVRFLPNPHWVDELRPLTGQHPAVRDYVLHRPGAAEFLESYHRLLSLVVDGYRRE 254
gi 1176171   157 EKELKIIVESFGFKYGIPLDADYVFDVRFLPNPHWDPTLRPMTGLEAPVAEFLNSHTEVNEFIYLTRHYIDTWLPMLEKN 236
gi 67476500  157 ERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETN 236
gi 2811049   168 GETFTVNVMSFGFKYGIPIDADLVFDVRFLPNPYYIESMRPLTGKDKEVSSYVMKWNETQKFNEKLIDLLSFMLPSYKRE 247
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 614085013 255 GKRYMTIAIGCTGGKHRSVAIAEALMGLLRSDQQLSVrALHRDLGRE 301
gi 1176171   237 NRSYLTIAIGCTGGKHRSVYIAQQLGEYFQAKGKTVK-IQHKSLERN 282
gi 67476500  237 NRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQ-SRHRTLEKR 282
gi 2811049   248 GKSQVVIAIGCTGGQHRSVTLAENLADYFKKDYYTHV--THRDIEKR 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap