Conserved Protein Domain Family
UPF0184

?
pfam03670: UPF0184 
Uncharacterized protein family (UPF0184)
Statistics
?
PSSM-Id: 112485
View PSSM: pfam03670
Aligned: 3 rows
Threshold Bit Score: 98.4847
Threshold Setting Gi: 20137722
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20137701   1 MSGPNGDPNISVEDGLINDDDDFGSEEYEAINSMLDQINSYLDDLEERNDSLNGKLHELMESNRQARLEFRAQLSnHTPQ 80
gi 20137930   1 MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLG-EAPS 79
gi 20137722   1 MSPKNNHDPSSSGDSGNTNVQEADLQEMEDVNNSLDALSCALDAVEQRTDDIMSQLRELLNSNREIRRLIAEEND-NAPE 79

                ....
gi 20137701  81 EDSA 84
gi 20137930  80 DASP 83
gi 20137722  80 SGDD 83
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap