Conserved Protein Domain Family
TFIID_20kDa

?
pfam03847: TFIID_20kDa 
Click on image for an interactive view with Cn3D
Transcription initiation factor TFIID subunit A
Statistics
?
PSSM-Id: 112650
View PSSM: pfam03847
Aligned: 8 rows
Threshold Bit Score: 85.8834
Threshold Setting Gi: 74948407
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
1H3O_B        7 TKKKLQDLVREV-----DPNEQLDEDVEEXLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWN 73
gi 42559733 416 SKRKLRELVKTVgidegDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWN 487
gi 1729812   93 TKPRLTELVREV-----DTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYN 159
gi 74948407  67 SKTNMLQFVQKI-----DANSSLDDQGCDMMARIADAFVNDISMRIVKLAKYRKSD-VSVLDLKFILKREFN 132
gi 75025340 230 eksKLDDLMQQI-----SSTTVLEENVKDVLVEYADDFVSSLIDKACKMIKNREVKKIESRDIEFILKNVYN 296
gi 75266219 401 GKRSIHELLQQI-----DPSEKLDPEVEDILSDIAEDFVESITTFGCSLAKHRKSDILEAKDILLHVERNWN 467
gi 75249490 529 GKRKIQDLVSQV-----DVHAKLDPDVEDLLLEVADDFIDSVTSFACSLAKHRKSSVLEPKDILLHLEKNLH 595
gi 74626601 344 SKRKLHDLLQQI-----DSEEKIEPEVEELLLEIADEFVESVTNFACRLAKHRKSDTLDVRDVQLHLERNWN 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap