Conserved Protein Domain Family
Sec20

?
pfam03908: Sec20 
Sec20
Sec20 is a membrane glycoprotein associated with secretory pathway.
Statistics
?
PSSM-Id: 112708
View PSSM: pfam03908
Aligned: 6 rows
Threshold Bit Score: 98.2627
Threshold Setting Gi: 93141310
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 93141310  133 QTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALF 212
gi 74870084  135 SQENDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLF 214
gi 134276    204 SKTKQLTNNLVRGNQILQSGILQSDLNLDELRAQTNSLTQIDDKYTQFETVFKKTADLVKVLENASHQEKRDVYLSLGFL 283
gi 74591069  148 SQNKQITKSLQASRQLLSAGILQSELNIDNIDQQTKDLYKLNEGFIQFNDLLNRSKKIVKFIEKQDKADRQRIYLSMGFF 227
gi 74582119  122 TSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRIIKSLKLSDRSDYFLVVSGFGFF 201
gi 297835514 143 SDAESITESLRRSRQLMVQEVERSTNTLVAFDESTGVLKKAESEYKGHRSLLSRTRNLLSTMQRQDVIDRIILIVGFSLF 222
                         90
                 ....*....|..
gi 93141310  213 LATVLYIVKKRL 224
gi 74870084  215 LACVFYIVQKRL 226
gi 134276    284 LCCVSWVLWRRI 295
gi 74591069  228 ILCCSWVVYRRI 239
gi 74582119  202 IFVVVYLLFKRI 213
gi 297835514 223 VFAVVYVVSKRI 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap