Conserved Protein Domain Family
Amb_V_allergen

?
pfam03913: Amb_V_allergen 
Amb V Allergen
Statistics
?
PSSM-Id: 112713
View PSSM: pfam03913
Aligned: 3 rows
Threshold Bit Score: 52.6494
Threshold Setting Gi: 114091
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40
              ....*....|....*....|....*....|....*....|....
gi 114090   1 LVPCAWAGNVCGEKRAYCCSDPGRYCPWQVVCYESSEICSKKCG 44
gi 1171002 23 VMACYAAGSICGEKRGYCSSDPGRYCPWQVVCYESRKICAKNAA 66
gi 114091  35 DGLCY-EGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap