Conserved Protein Domain Family
PPK2

?
pfam03976: PPK2 
Click on image for an interactive view with Cn3D
Polyphosphate kinase 2 (PPK2)
Inorganic polyphosphate (polyP) plays a role in metabolism and regulation and has been proposed to serve as a energy source in a pre-ATP world. In prokaryotes, the synthesis and utilisation of polyP are catalyzed by PPK1, PPK2 and polyphosphatases. Proteins with a single PPK2 domain catalyze polyP-dependent phosphorylation of ADP to ATP, whereas proteins containing 2 fused PPK2 domains phosphorylate AMP to ADP. The structure of PPK2 from Pseudomonas aeruginosa has revealed a a 3-layer alpha/beta/alpha sandwich fold with an alpha-helical lid similar to the structures of microbial thymidylate kinases.
Statistics
?
PSSM-Id: 112775
View PSSM: pfam03976
Aligned: 10 rows
Threshold Bit Score: 343.964
Threshold Setting Gi: 81552021
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3CZP_A      270 YLdkdAYKEQLAAEQARLAGLIRDKRFRQHS-LVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLW 348
gi 81542067  33 RN---EYEKAKHDLQIELLKVQSWVKETGQR-VVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQWYFQ 108
gi 81545318   3 KLdkkVYERELELLQIELVKLQEWVKQEKLK-LVVIFEGRDAAGKGGVIKTITEKLNPRVCRVAALPAPTEKEKTQWYFQ 81
gi 81540878  48 ELsrrRYFRELFRLQRELVKLQNWVVHTGHK-VVILFEGRDAAGKGGVIKRITQRLNPRVCRVAALPAPNDREQTQWYFQ 126
gi 81776144 111 SIdrmQYFRDLITLQSELIKLQSWVAYHKKK-LVVIFEGRDSAGKGGVIKRITQRLNPRICRVVALPAPTEREKSQWYFQ 189
gi 81552021  26 GLskeEGQAQTAKLAGELAEWQERLYAEGKQsLLLILQARDAAGKDGAVKKVIGAFNPAGVQITSFKQPSAEELSHDFLW 105
gi 81670757 270 QLskdDYRQRLRDSQIELRKLQAKIYQEKVP-VIALFEGWDAAGKGGAIKRLTDTLDPRSYQVNTFAAPTEEEAQFHYLW 348
gi 81668600  32 KIsdaVYQAELFRLQTEFVKLQEWARHSGAR-LVVIFEGRDGAGKGGAIKRITEYLNPRVARIAALPAPTDRERGQWYYQ 110
gi 81778099  53 KMnsdEYDETLEKLQIELVKAQAWLQATGKR-VMALFEGRDAAGKGGTIFVVRQYLNPRTARNVALTKPTPTELGQWYYQ 131
gi 81534306   1 MSksdDDEAELVQLQLALIALQKKAIKDGDK-ILVVFEGRDAAGKDGVIARITEHLSRRATTVVALPKPTDRERSEWYFQ 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3CZP_A      349 RFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQXERFKEREKT 428
gi 81542067 109 RYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLTNSGILLFKYWFSVSREEQLRRFISRRDD 188
gi 81545318  82 RYVAHLPAGGEIVLFDRSWYNRAGVEKVMGFCSDEEYQEFLRSCPEFERMLQRSGIILLKYWFSVSDEEQERRFIERINT 161
gi 81540878 127 RYVSHLPAGGEIVLFDRSWYNRAGVERVMGFCNDEQYEEFFRSVPEFEKMLARSGIQLLKYWFSISDAEQHLRFLSRIHD 206
gi 81776144 190 RYVPHLPAGGEIVLFDRSWYNRSGVERVMGFADAGQVEEFFRDVPEFERMLVRSGITVVKYWFSITDEEQQMRFLMRIHD 269
gi 81552021 106 RIHQKAPAKGYVGVFNRSQYEDVLVTRVYDMIDDKTAKRRLEHIRHFEELLTDNATRIVKVYLHISPEEQKERLQARLDN 185
gi 81670757 349 RFWRRIPPGGKISIFDRSWYGRVMVERVEGFAREKEWLRAYREINELEAELTAEGYVVVKFFLHISPEEQLARFEERQNN 428
gi 81668600 111 RYIAHLPAKGEIVLFDRSWYNRAGVEKVMGFCTPQEYVLFLRQTPIFEQMLIDDGILLRKYWFSVSDAEQLRRFKARRND 190
gi 81778099 132 RYVDHFPTAGEFVTFDRSWYNRAGVEPVMGFCTPEQHEKFLDETPHFERMIVNDDIHFFKFWLNIGRETQLERFHDRRYS 211
gi 81534306  80 RYVEWLPACGEAVLFNRSWYNRAGVERVMDFSTPQQQEQFLRDVPAFERMLVENGMRYVKFWLDISREEQAKRLKSRRED 159
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3CZP_A      429 PYKRYKITEEDWRNRDKWDQYVDAVGDXVDRTSTEIAPWTLVEANDKRFARVKVLRTINDAIEAAYKKDK 498
gi 81542067 189 PLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDTADAPWTVIKSDDKKRARLNCIRHFLHSLDYPDKDRR 258
gi 81545318 162 PLKRWKFSPMDLESRQRWAAYSRAKDEMFAYTDTKHCPWWVVPSDDKKRARLNCISHLLSSVEYQEIEHA 231
gi 81540878 207 PLKQWKLSPMDLESRRRWEAYTKAKETMLERTHIPEAPWWVVQADDKKRARLNCIHHLLQQMPYREVPQP 276
gi 81776144 270 PMKQWKLSPMDLQSRVRWEQYTKAKEETFARTNIPEAPWFIVEGNDKKRARLNCIDHLLKQMPYEEVPHE 339
gi 81552021 186 PGKHWKFNPGDLKDRSNWDKFNDVYEDALT-TSTDDAPWYVVPADRKWYRDLVLSHILLGALKDMNPQFP 254
gi 81670757 429 PFKQYKLTDEDWRNREKWPLYDVAVNQMIARTNTPVAPWTVVPANDKYFARVQVIQTVVDAVKMELKRRG 498
gi 81668600 191 PVRQWKLSPMDLESVYRWEDYSRAKDEMMVHTDTPVSPWYVVESDIKKHARLNMMAHLLSTIDYADVEKP 260
gi 81778099 212 PLKSWKFSPIDVAGITKWDDYTKARDSMFKRTHKEFAPWIIVRANDKRRARLAVMRRILLSLPYEGRDLD 281
gi 81534306 160 PLKAFKTSPLDAVAQEKWDDYTKARDEMLMRTHSDIAPWICVRADHKKAARLNVIR-WLLHAAGDKKILK 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap