Conserved Protein Domain Family
DAGAT

?
pfam03982: DAGAT 
Diacylglycerol acyltransferase
The terminal step of triacylglycerol (TAG) formation is catalyzed by the enzyme diacylglycerol acyltransferase (DAGAT).
Statistics
?
PSSM-Id: 112781
View PSSM: pfam03982
Aligned: 6 rows
Threshold Bit Score: 390.636
Threshold Setting Gi: 75167729
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74966535  63 HVLFNTRWWFLVPLYAVWFYYDFDTPKKASRRWNWARRHVAWKYFASYFPLRL-IKTAD-LPADRNYIIGSHPHGMFSVG 140
gi 75028484  50 FVLFFTGQWIILGLYAVWYLYDRESPRRGGYRDNWFRNLSLHKWFAEYFPVKL-HKTAE-LDPNQNYLFGYHPHGILGVG 127
gi 75023261  44 FFLLFTFQWHILALYACWYFYDMDSPRRGGYSSDWVRKWRVNDWFAQYFPINL-HKTAE-LSTDKNYLVGIHPHGIISMA 121
gi 74956204  55 YMLY-TVLWPLIFLYGLWMIYDWNSPKKGAYMSNWFQRQRIHSWYANYFPVKL-HTTSD-MPEEHNYLIGYHPHGIISMA 131
gi 81881828  92 MYTFCTDCWLIAVLYFTWLAFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQL-VKTHN-LLTTRNYIFGYHPHGIMGLG 169
gi 75167729  39 SLIFLPPSLSLMVLGLLSLFIFIPIDHRSKYGRKLAR--YICKHACNYFPVSLyVEDYEaFQPNRAYVFGYEPHSVLPIG 116
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74966535 141 GFTAMSTNATGFEDKFPGIKSHIMTLN--GQFYFPFRREFGIMLGGIEVSKESLEYTLTKCGK-GRACAIVIGGASEALE 217
gi 75028484 128 AWSCFGFDACNVKQVFKGIRFNICTLP--GNFTAMFRREILLSIGMIESSKESIEHVLNSEEK-GRAVVIVVGGAAEALE 204
gi 75023261 122 AWSNFATNGTGIYEKFPGIRWNLCTLA--LQFRMAIRRELLLLTGLIDCSRESIEYVLDKCGQkGRAVVLVIGGAEEALD 199
gi 74956204 132 AFINFATNGTGILDTLPRIRFHLCTLV--GQFWTPWRREWGLLHGMIDCSRESIKHVLEHEKK-GKAVVLVVGGAEEALD 208
gi 81881828 170 AFCNFSTEATEVSKKFPGIRPYLATLA--GNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGS-GNAIIIVVGGAAESLS 246
gi 75167729 117 V-VALC-DLTGFMPI-----PNIKVLAssAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYS----CVLVPGGVQETFH 185
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74966535 218 AHPNKNTLTLINRRGFCKYALKFGADLVPMYNFGENDLYEQYENPKGSRLREVQEKIKDMFGLCPPLLRGRSLFNqYLIG 297
gi 75028484 205 AHPGKHTLTLANRKGFVREAVKTGAHLVPVYAFGENDIYKQIDNPEGSKLRKIQEWGKKKMGISLPLIYGRGYFQ-MALG 283
gi 75023261 200 AHPGYHTLTLASRKGFVREALITGAYLVPVYSFGENDVFEQMENPVGSRLRNFQEWCKSIFGISYPIFHGRGFFQ-LTFG 278
gi 74956204 209 AHPGCHILTLKKRKGFVKIALQTGAQLVPCYSFGENDIFNQAENPKGSTIRQFQTIMKRVLGFSPPAFYGRGVFN-YTFG 287
gi 81881828 247 SMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSsDTWG 326
gi 75167729 186 MQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCDLYL-----KLSRAIRFTPICFWG--VFGsP--- 255
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 74966535 298 LLPFRKPVTTVMGRPIRVTQTDEPTVEQIDELHAKYCDALYNLFEEYKHLHSIPPDTHLIFQ 359
gi 75028484 284 LLPMSRAVNVVVGAPIQVEKELDPSKEVIDEIHGVYMEKLAELFEEHKAKFGVSKDTRLVFQ 345
gi 75023261 279 YLPFRKPIDTVVGAPIPVEKVENPTKEQIDELHTIYCQKLTELFDEHKEKYGVEKDVPLVLR 340
gi 74956204 288 LLPFRKPINTVLGAPISVTKTVNPTQEQIDTLHQTYMDRLHELFEEHKTKYDVSPTTQLVIN 349
gi 81881828 327 LVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFGLPETEVLEVN 388
gi 75167729 256 -LPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRVG----YDLELK 312
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap